ESTScan Details for Unigene SGN-U211285

Score 
665
Direction 
Forward
Predicted Peptide Sequence 
EEMAEMMSVXHLATSTSLIISIFNNSPLIISTTCRKLDTKLVMAARRLSSLLSNSLRHLPSASAPLGRSHGVSRYIKRFSTAAAVEEVIT
PPVQVNYTKLLINGQFVDSASGKTFPTLDPRTGEVIANVVEGDAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHTDELA
ALETWDNGKPYSQAVQAEVPSFVRLFRYYAGWA
Predicted Coding Sequence 
GAGGAAATGGCTGAAATGATGTCAGTTGXTCACTTAGCCACTAGCACCTCACTCATCATCTCTATCTTTAATAACTCXCCACTAATCATC
TCAACCACTTGTAGAAAACTTGACACCAAGCTGGTCATGGCTGCTAGAAGACTTTCTTCTTTGCTCTCTAATTCTCTAAGACATCTTCCT
TCTGCTTCTGCTCCTTTAGGAAGGAGCCATGGTGTATCAAGGTACATCAAAAGGTTTAGTACAGCTGCAGCAGTTGAGGAAGTAATCACT
CCACCTGTCCAAGTTAATTACACCAAGCTTCTAATCAATGGTCAATTCGTTGATTCTGCATCTGGAAAAACATTCCCAACTTTGGATCCA
AGAACTGGGGAAGTCATTGCAAATGTTGTTGAAGGCGATGCGGAAGATATTAATCGCGCTGTGGCTGCTGCTCGCAAGGCATTTGATGAG
GGACCGTGGCCTAAAATGAGTGCTTATGAGAGGTCACGGATAATGTTAAAGTTTGCTGATTTGGTGGAGAAACACACTGATGAGCTTGCA
GCTTTAGAAACATGGGATAATGGCAAGCCATATTCGCAGGCTGTACAAGCTGAAGTGCCTTCTTTTGTGCGACTATTTCGGTATTATGCT
GGCTGGGCA\
Edits in Original Sequence 
(5')GAGGAAATGGCTGAAATGATGTCAGTTGXTCACTTAGCCACTAGCACCTCACTCATCATCTCTATCTTTAATAACTCXCCACTAAT
CATCTCAACCACTTGTAGAAAACTTGACACCAAGCTGGTCATGGCTGCTAGAAGACTTTCTTCTTTGCTCTCTAATTCTCTAAGACATCT
TCCTTCTGCTTCTGCTCCTTTAGGAAGGAGCCATGGTGTATCAAGGTACATCAAAAGGTTTAGTACAGCTGCAGCAGTTGAGGAAGTAAT
CACTCCACCTGTCCAAGTTAATTACACCAAGCTTCTAATCAATGGTCAATTCGTTGATTCTGCATCTGGAAAAACATTCCCAACTTTGGA
TCCAAGAACTGGGGAAGTCATTGCAAATGTTGTTGAAGGCGATGCGGAAGATATTAATCGCGCTGTGGCTGCTGCTCGCAAGGCATTTGA
TGAGGGACCGTGGCCTAAAATGAGTGCTTATGAGAGGTCACGGATAATGTTAAAGTTTGCTGATTTGGTGGAGAAACACACTGATGAGCT
TGCAGCTTTAGAAACATGGGATAATGGCAAGCCATATTCGCAGGCTGTACAAGCTGAAGTGCCTTCTTTTGTGCGACTATTTCGGTATTA
TGCTGGCTGGGCA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan