ESTScan Details for Unigene SGN-U211310

Score 
224
Direction 
Forward
Predicted Peptide Sequence 
EAAEQNGDEVLEPREDDVQQEGQEEAVVVDADSTDGAVLVNGDEADEEWGTNTEGKPVSLKAIGWVGGNPSFIAVLTPXSLGLARQMVPV
VCNPFLRFTSCTLKGTVQGTGVCSASGVIPSMSFWRHTIEX
Predicted Coding Sequence 
XXTGAGGCTGCAGAGCAAAATGGTGATGAGGTACTAGAACCAAGGGAAGATGACGTTCAACAAGAGGGCCAAGAAGAGGCTGTTGTGGTG
GATGCTGACTCTACTGATGGTGCAGTACTCGTTAATGGAGACGAGGCTGACGAAGAGTGGGGTACGAATACTGAAGGAAAACCXGTCAGC
CTAAAAGCAATTGGTTGGGTTGGTGGAAATCCTAGTTTTATTGCTGTTCTTACACCACXGTCATTAGGTTTGGCAAGACAAATGGTTCCA
GTTGTATGTAATCCATTCTTAAGATTCACTAGTTGCACCCTTAAAGGGACGGTTCAAGGGACCGGAGTCTGTTCTGCCAGTGGTGTGATT
CCTAGCATGAGCTTCTGGCGGCATACCATAGAAGAX\
Edits in Original Sequence 
(5')XXTGAGGCTGCAGAGCAAAATGGTGATGAGGTACTAGAACCAAGGGAAGATGACGTTCAACAAGAGGGCCAAGAAGAGGCTGTTGT
GGTGGATGCTGACTCTACTGATGGTGCAGTACTCGTTAATGGAGACGAGGCTGACGAAGAGTGGGGTACGAATACTGAAGGAAAACCXGT
CAGCCTAAAAGCAATTGGTTGGGTTGGTGtGAAATCCTAGTTTTATTGCTGTTCTTACACCACXGTCATTAGGTTTGGCAAGACAAATGG
TTCCAGTTGTATGTAATCCATTCTTAAGATTCACTAGTTGCACCCTTAAAGGGACGGTTCAAGGGACCGGAGTCTGTTCTGCCAGTGGTG
TGATTCCgTAGCATGAGCTTCTGGCGGCATACCATAGAAGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan