ESTScan Details for Unigene SGN-U211313

Score 
119
Direction 
Forward
Predicted Peptide Sequence 
GQKGAICPHKLRCDWDSAHPVLSEPLGADVYVGQPKGNDWFEKQTAGTIDIDCYSWMDWFYGGLQFQLEHHLFPRLPRCQLRKISPIVQE
LCKKHNLPYRSMSFYDANLWTIKTLRTAAMQARNLLWEAVNXPWLVFLLHDTEDSRKS
Predicted Coding Sequence 
GGACAAAAGGGTGCTATTTGTCCTCATAAGCTTCGCTGTGACTGGGATTCAGCACATCCAGTTCTGTCTGAACCACTTGGTGCTGATGTC
TATGTTGGACAGCCCAAGGGGAACGATTGGTTCGAGAAACAAACCGCTGGAACTATCGACATTGATTGTTATTCTTGGATGGATTGGTTC
TATGGAGGATTGCAGTTTCAGCTTGAGCATCATCTTTTTCCAAGGCTGCCTAGGTGCCAACTGAGGAAGATTTCTCCGATTGTACAGGAG
CTATGCAAAAAGCATAATTTGCCTTACAGGAGTATGTCCTTCTATGACGCCAACTTATGGACAATAAAGACACTTAGGACTGCAGCAATG
CAGGCTAGAAACCTGCTTTGGGAAGCTGTTAACAXCCCATGGCTAGTATTTCTTTTGCACGATACTGAAGATTCTCGTAAGTCX\
Edits in Original Sequence 
(5')GGACAAAAGGGTGCTATTTGTCCTCATAAGCTTCGCTGTGACTGGGATTCAGCACATCCAGTTCTGTCTGAACCACtTTGGTGCTG
ATGTCTATGTTGGACAGCCCAAGGGGAACGATTGGTTCGAGAAACAAACCGCTGGAACTATCGACATTGATTGTTATTCTTGGATGGATT
GGTTCTATGGAGGATTGCAGTTTCAGCTTGAGCATCATCTTTTTCCAAGGCTGCCTAGGTGCCAACTGAGGAAGATTTCTCCGATTGTAC
AGGAGCTATGCAAAAAGCATAATTTGCCTTACAGGAGTATGTCCTTCTATGACGCCAACTTATGGACAATAAAGACACTTAGGACTGCAG
CAATGCAGGCTAGAAACCTGCTTTGGGAAGCTGTTAACAXCCCATGGCTAGTATTTCTTTTGCACGATACTGAAGATTCTCGTAAGTCX\
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan