ESTScan Details for Unigene SGN-U211404

Score 
420
Direction 
Forward
Predicted Peptide Sequence 
MFDKIIVLTEGCPIYSGKNSHVMEYFSSIGYAPGSNFMNPADFLLDLANGMSPDTRQDELHESLPKPDQTDNQNATKQFLITSYKKSIYP
ALKEEIDQSFRNPALSRGQFPSRSHENEXGPQVGGYNSMFRWAEDFKNENMSPFQALEFSKSSLX
Predicted Coding Sequence 
ATGTTTGATAAGATTATTGTGTTAACTGAAGGTTGTCCAATTTACAGTGGAAAAAACAGCCATGTTATGGAGTATTTTTCATCCATTGGT
TATGCTCCTGGATCCAATTTCATGAACCCTGCTGATTTTCTGCTTGATCTAGCTAATGGTATGTCTCCTGATACAAGGCAAGATGAACTG
CATGAATCTCTACCAAAACCAGATCAGACTGACAATCAAAATGCAACCAAACAGTTCTTGATAACCTCCTACAAAAAGAGCATATATCCA
GCTTTGAAGGAGGAAATTGATCAAAGTTTCAGGAATCCAGCTCTTTCAAGAGGACAATTTCCATCAAGAAGTCATGAAAATGAAXTAGGA
CCACAAGTAGGTGGTTACAATTCAATGTTTCGCTGGGCAGAGGACTTCAAGAACGAAAACATGAGTCCTTTTCAGGCTTTAGAATTTTCC
AAGTCATCTCTGTTX\
Edits in Original Sequence 
GACAGTTATCACAACAATACATCAACCTTCAACCAGATTATACAGA(5')ATGTTTGATAAGATTATTGTGTTAACTGAAGGTTGTCCAA
TTTACAGTGGAAAAAACAGCCATGTTATGGAGTATTTTTCATCCATTGGTTATGCTCCTGGATCCAATTTCATGAACCCTGCTGATTTTC
TGCTTGATCTAGCTAATGGTATGTCTCCTGATACAAGGCAAGATGAACTGCATGAATCTCTACCAAAACCAGATCAGACTGACAATCAAA
ATGCAACCAAACAGTTCTTGATAACCTCCTACAAAAAGAGCATATATCCAGCTTTGAAGGAGGAAATTGATCAAAGTTTCAGGAATCCAG
CTCTTTCAAGAGGACAATTTCCATCAAGAAGTCATGAAAATGAAXTAGGACCACAAGTAGGTGGTTACAATTCAATGTTTCGCTGGGCAG
AGGACTTCAAGAACGAAAACATGAGTCCTTTTCAGGCTTTAGAATTTTCCAAGTCATCTCTGTTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan