ESTScan Details for Unigene SGN-U211414

Score 
108
Direction 
Forward
Predicted Peptide Sequence 
MTTRGFNKLVQISTGNCLTGISIAWWKWTHNAHHAACNSLDYDPDLQHLPVFAVSSSLFKSLNSRFYGRELTFDSLAKFFXELSAFYILS
DHMRIQGESIYPDIVALVLERKVPDRFLNILGXPGFLDLVSTSCFNLAQLDRKGVICPHKLRCDRDSAHPVLSEPLGADVY
Predicted Coding Sequence 
ATGACGACTCGCGGTTTCAACAAATTGGTACAAATTTCCACAGGCAATTGTCTCACTGGGATTAGTATTGCTTGGTGGAAATGGACACAT
AATGCCCATCATGCGGCCTGTAATAGCCTTGATTATGACCCTGATCTTCAGCACTTGCCTGTTTTTGCGGTCTCTTCGAGTCTGTTTAAG
TCACTGAATTCTAGATTCTATGGGAGAGAGCTCACGTTCGATTCCCTGGCTAAATTCTTTGXTGAGCTATCAGCATTTTACATTCTATCC
GATCATATGCGTATCCAGGGTGAATCTATTTATCCAGACATTGTTGCTCTTGTTCTCGAGAGGAAAGTGCCTGATAGATTTTTGAACATC
TTAGGAAXTCCTGGTTTTCTGGACTTGGTTTCCACTTCTTGTTTTAACCTTGCCCAATTGGACAGAAAGGGTGTTATTTGTCCTCATAAG
CTTCGCTGTGACCGGGATTCAGCACATCCAGTTCTGTCTGAACCACTTGGTGCCGATGTCTAT\
Edits in Original Sequence 
GTGCACATGATTTGTGGGGGTTTATNGGGGTTTTCTTGGATGCAAGTTTCTTATTTGGGCCATGATTCTGGGCATTATTTAATC(5')AT
GACGACTCGCGGTTTCAACAAATTGGTACAAATTTCCACAGGCAATTGTCTCACTGGGATTAGTATTGCTTGGTGGAAATGGACACATAA
TGCCCATCATGCGGCCTGTAATAGCCTTGATTATGACCCTGATCTTCAGCACTTGCCTGTTTTTGCGGTCTCTTCGAGTCTGTTTAAGTC
ACTGAATTCTAGATTCTATGGGAGAGAGCTCACGTTCGATTCCCTGGCTAAATTCTTTGXTGAGCTATCAGCATTTTACATTCTATCCGA
TCATATGCGTATCCAGGGTGAATCTATTTATCCAGACATTGTTGCTCTTGTTCTCGAGtAGGAAAGTGCCTGATAGATTTTTGAACATCT
TAGGAAXTCCTGGTTTTCTGGACTTGGTTTCCACTTCTTGTTTTAACCTTGCCCAATTGGACAGAAAGGGTGTTATTTGTCCTCATAAGC
TTCGCTGTGACCGGGATTCAGCACATCCAGTTCTGTCTGAACCACtTTGGTGCCGATGTCTAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan