ESTScan Details for Unigene SGN-U211540

Score 
412
Direction 
Reverse
Predicted Peptide Sequence 
DGQGLKLVAAVRTTYPVAVYQVDKVLLPEAIFGTDLPPMPAPAPAPVKDIAPAADSPAADQIGKAAASPDFFHHHQLSHRMMSWGILNQL
VLAIAGGFLMFFL
Predicted Coding Sequence 
GATGGTCAAGGACTAAAGTTAGTAGCXGCTGTTCGCACTACTTATCCGGTCGCTGTTTATCAGGTGGATAAGGTCCTTCTTCCTGAAGCC
ATTTTTGGAACAGATTTACCTCCAATGCCAGCACCAGCCCCTGCACCAGTAAAAGACATTGCCCCTGCTGCTGATAGTCCAGCTGCTGAT
CAAATTGGCAAAGCAGCAGCCTCTCCAGATTTCTTTCATCACCATCAGCTNTCTCACAGGATGATGAGCTGGGGTATTTTGAATCAATTG
GTTTTGGCAATTGCTGGTGGATTCTTGATGTTTTTCTTGTAA\
Edits in Original Sequence 
TTTCGACATAGTTGGTTCCATAAGCTCGTCTGGTCAAATCAGAAAGATTCAATTGGATTTGATCCTCGTGCCGAATTCGGCACGAG(5')
GATGGTCAAGGACTAAAGTTAGTAGCXGCTGTTCGCACTACTTATCCGGTCGCTGTTTATCAGGTGGATAAGGTCCTTCTTCCTGAAGCC
ATTTTTGGAACAGATTTACCTCCAATGCCAGCACCAGCCCCTGCACCAGTAAAAGACATTGCCCCTGCTGCTGATAGTCCAGCTGCTGAT
CAAATTGGCAAAGCAGCAGCCTCTCCAGATTTCTTTCATCACCATCAGCTNTCTCACAGGATGATGAGCTGGGGTATTTTGAATCAATTG
GTTTTGGCAATTGCTGGTGGATTCTTGATGTTTTTCTTGTAA\(3')GGAAATGATTTGTTTGGGGGAGATTTGTTAATTTATGTTAAAC
ATGGTACATCTGTTTCTTATTGGTTGATATACACCATTCGTTTTTGTTAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan