ESTScan Details for Unigene SGN-U211547

Score 
586
Direction 
Forward
Predicted Peptide Sequence 
GNYARIAKVHSCESGLNEDIFEEMFGVAVQAVRMNYYPACPRPDLVLGLSPHSDGSALTVLQQGKCSSVGLQILKDNVWVPVQPIPNALV
INIGDTIEVLTNGRYKSVEHRAVTHQEKDRLSIVTFYAPSYEIELGPLPELVDENNPCKYRRYNHGEYSMHYVTNKLQGKKTLEFAKIYN
N
Predicted Coding Sequence 
GGAAACTATGCAAGAATTGCTAAAGTACATAGCTGTGAGTCTGGATTGAATGAGGATATTTTTGAGGAAATGTTTGGAGTTGCTGTACAA
GCAGTGAGGATGAATTACTATCCAGCATGTCCTAGACCAGATCTTGTGTTGGGGCTAAGTCCCCATTCAGATGGAAGTGCACTTACAGTG
TTACAACAAGGTAAATGCAGCTCAGTTGGCTTGCAAATACTTAAAGATAATGTTTGGGTGCCTGTCCAGCCAATTCCAAATGCACTTGTT
ATCAACATTGGTGACACCATTGAGGTTTTAACTAATGGGAGATACAAGAGTGTAGAGCACAGAGCAGTGACACACCAAGAAAAGGATAGG
CTATCCATTGTGACATTTTATGCACCAAGTTATGAAATTGAGTTAGGACCACTGCCAGAACTGGTTGATGAAAACAACCCTTGCAAGTAC
AGGAGGTACAATCATGGAGAGTACAGCATGCACTATGTTACTAACAAGCTTCAAGGCAAGAAAACTCTTGAGTTTGCAAAAATCTATAAT
AACTAA\
Edits in Original Sequence 
(5')GGAAACTATGCAAGAATTGCTAAAGTACATAGCTGTGAGTCTGGATTGAATGAGGATATTTTTGAGGAAATGTTTGGAGTTGCTGT
ACAAGCAGTGAGGATGAATTACTATCCAGCATGTCCTAGACCAGATCTTGTGTTGGGGCTAAGTCCCCATTCAGATGGAAGTGCACTTAC
AGTGTTACAACAAGGTAAATGCAGCTCAGTTGGCTTGCAAATACTTAAAGATAATGTTTGGGTGCCTGTCCAGCCAATTCCAAATGCACT
TGTTATCAACATTGGTGACACCATTGAGGTTTTAACTAATGGGAGATACAAGAGTGTAGAGCACAGAGCAGTGACACACCAAGAAAAGGA
TAGGCTATCCATTGTGACATTTTATGCACCAAGTTATGAAATTGAGTTAGGACCACTGCCAGAACTGGTTGATGAAAACAACCCTTGCAA
GTACAGGAGGTACAATCATGGAGAGTACAGCATGCACTATGTTACTAACAAGCTTCAAGGCAAGAAAACTCTTGAGTTTGCAAAAATCTA
TAATAACTAA\(3')TCCTGTAGAGTCCTTTTTTTTTTCCTTTCTTTGCTCCTATTAACTTGAGATGTAGAATATTGACATAATGTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan