ESTScan Details for Unigene SGN-U211603

Score 
606
Direction 
Forward
Predicted Peptide Sequence 
MGAQTKQYTLAEVSKHNNSKDCWLIISGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFEDVGHSSSARAMLDEYHVGDIDSATIPSKVE
YTPPKQPHYNQDKTSEFIIKLLKFLVPVIILGVAVGIHFYTKXVSLKIEYGDDQNKNPNQ
Predicted Coding Sequence 
ATGGGTGCTCAAACTAAGCAATACACTTTAGCTGAGGTCTCTAAGCACAACAACTCAAAGGATTGTTGGCTCATTATTAGTGGCAAGGTG
TATGATGTGACAAAATTCTTGGAAGACCACCCAGGTGGTGATGACGTTTTATTGTCTGCAACAGGAAAGGATGCAACCGATGATTTTGAG
GACGTCGGCCATAGCAGTAGCGCTCGAGCAATGTTGGATGAGTATCATGTAGGTGATATTGATTCTGCAACCATTCCATCAAAGGTCGAG
TACACTCCTCCTAAGCAGCCTCATTACAACCAGGACAAAACATCAGAGTTCATCATCAAGCTCCTCAAGTTCTTGGTTCCTGTGATTATT
TTGGGTGTAGCTGTTGGCATCCACTTCTACACCAAAXCAGTCAGCTTGAAGATTGAGTATGGTGATGATCAGAATAAGAATCCAAATCAG
TGA\
Edits in Original Sequence 
CATTCCCGACTTGAAGACTCAAAATCAAAATCTAATTAATCTTTTGTATCTTTAA(5')ATGGGTGCTCAAACTAAGCAATACACTTTAG
CTGAGGTCTCTAAGCACAACAACTCAAAGGATTGTTGGCTCATTATTAGTGGCAAGGTGTATGATGTGACAAAATTCTTGGAAGACCACC
CAGGTGGTGATGACGTTTTATTGTCTGCAACAGGAAAGGATGCAACCGATGATTTTGAGGACGTCGGCCATAGCAGTAGCGCTCGAGCAA
TGTTGGATGAGTATCATGTAGGTGATATTGATTCTGCAACCATTCCATCAAAGGTCGAGTACACTCCTCCTAAGCAGCCTCATTACAACC
AGGACAAAACATCAGAGTTCATCATCAAGCTCCTCAAGTTCTTGGTTCCTGTGATTATTTTGGGTGTAGCTGTTGGCATCCACTTCTACA
CCAAAXCAGTCAGCTTGAAGATTGAGTATGGTGATGATCAGAATAAGAATCCAAATCAGTGA\(3')GACATCAGAAGAACAAAATTCTT
TC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan