ESTScan Details for Unigene SGN-U211655

Score 
395
Direction 
Forward
Predicted Peptide Sequence 
DANVSFLRITHYKAQNEDGKTSGLLGHTDAGFLSIIKQNQAGLELLNKNGEWTKVNVTPNSYIVLSADSFKAWTNGRVQSPMHRVTIEDT
DRYSMQIFSAPVPDYTVKAPKELVDEEHPLLLKPYNMSGYYKYVLSGSKAGHGLEAYCSTV
Predicted Coding Sequence 
XXTGATGCTAACGTTTCCTTTCTGCGGATTACTCATTACAAGGCTCAAAATGAAGATGGAAAAACATCAGGATTGCTTGGCCATACAGAT
GCTGGCTTCTTGTCAATAATAAAACAAAACCAAGCTGGATTGGAACTTCTTAACAAAAATGGAGAGTGGACAAAGGTCAATGTTACACCA
AATTCCTACATCGTCTTATCAGCAGATTCCTTCAAAGCATGGACAAATGGTCGAGTGCAGTCTCCCATGCATAGGGTCACAATAGAGGAC
ACTGATAGGTACTCTATGCAGATATTTTCAGCACCAGTACCTGATTATACTGTTAAGGCTCCAAAAGAATTAGTGGATGAAGAACACCCT
TTACTCTTAAAGCCCTATAACATGAGCGGATATTATAAATATGTTCTGTCTGGATCTAAAGCTGGCCATGGTCTCGAGGCTTATTGCAGC
ACTGTCTGA\
Edits in Original Sequence 
(5')XXTGATGCTAACGTTTCCTTTCTGCGGATTACTCATTACAAGGCTCAAAATGAAGATGGAAAAACATCAGGATTGCTTGGCCATAC
AGATGCTGGCTTCTTGTCAATAATAAAACAAAACCAAGCTGGATTGGAACTTCTTAACAAAAATGGAGAGTGGACAAAGGTCAATGTTAC
ACCAAATTCCTACATCGTCTTATCAGCAGATTCCTTCAAAGCATGGACAAATGGTCGAGTGCAGTCTCCCATGCATAGGGTCACAATAGA
GGACACTGATAGGTACTCTATGCAGATATTTTCAGCACCAGTACCTGATTATACTGTTAAGGCTCCAAAAGAATTAGTGGATGAAGAACA
CCCTTTACTCTTAAAGCCCTATAACATGAGCGGATATTATAAATATGTTCTGTCTGGATCTAAAGCTGGCCATGGTCTCGAGGCTTATTG
CAGCACTGTCTGA\(3')TTCGCTCTAATGCTTAAGCTACTGTTTTCTATATATTTTATGTTATTTCGCATCTTGCTCTCTATTATTCCT
CCGTAATAATGTCAGTCAAAACTTTATGAGGATTTTACAAGTCTTTTCTATTTGTGTAATGATTTGTAGTAACTTATGCTTTCTCAAGTA
AAACAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan