ESTScan Details for Unigene SGN-U211849

Score 
274
Direction 
Forward
Predicted Peptide Sequence 
MAEVCHGVVTKPEPSPPCESSNTQAARRRRMELRKVKFISGETGSGIKRPKLEFYSNSVSRFCDNNAVDKSSTNDDDQLSLAVKGSTPTI
ILAPIISPLNSTCLVREVANPK
Predicted Coding Sequence 
ATGGCAGAGGTCTGCCACGGAGTAGTAACTAAACCTGAGCCATCACCGCCGTGTGAGTCGTCAAATACACAGGCGGCGAGGCGACGGAGA
ATGGAGCTTAGAAAAGTAAAATTTATCTCCGGTGAAACAGGAAGTGGAATCAAACGTCCAAAGTTAGAATTTTATTCTAATTCTGTTTCA
AGATTTTGTGACAATAATGCTGTGGACAAGTCTAGCACAAATGATGATGACCAGTTGAGTTTAGCGGTTAAAGGGTCAACACCAACTATT
ATTTTGGCTCCCATTATAAGTCCTTTGAATTCAACTTGTCTTGTTCGGGAAGTAGCAAATCCGAAG\
Edits in Original Sequence 
CAACTTTGCTTTCTCCATTCATAGTATTAACTGTGGACTATTTGTCTTGGTGGGATTCTTGAAACTGCAGCCTTGTTCAAAGTTAAGCAT
ATATAAACTCTCAACAAAGTTAGTAATTATTTAAAGGGTGTTATTGGTTTCCTTCTTGTACAAGTGA
(5')ATGGCAGAGGTCTGCCACG
GAGTAGTAACTAAACCTGAGCCATCACCGCCGTGTGAGTCGTCAAATACACAGGCGGCGAGGCGACGGAGAATGGAGCTTAGAAAAGTAA
AATTTATCTCCGGTGAAACAGGAAGTGGAATCAAACGTCCAAAGTTAGAATTTTATTCTAATTCTGTTTCAAGATTTTGTGACAATAATG
CTGTGGACAAGTCTAGCACAAATGATGATGACCAGTTGAGTTTAGCGGTTAAAGGGTCAACACCAACTATTATTTTGGCTCCCATTATAA
GTCCTTTGAATTCAACTTGTCTTGTTCGGGAAGTAGCAAATCCGAAG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan