ESTScan Details for Unigene SGN-U211920

Score 
186
Direction 
Forward
Predicted Peptide Sequence 
RTQQRSNRSLPLGGMDYADPKKKSNFVGKILMAAVLTALCILMIKQSPNFSTPSVFSRHEPGVTHVLVTGGAGYIGSHAALRLLKESYRV
TIVDNX
Predicted Coding Sequence 
XXAAGAACTCAGCAAAGGTCTAATAGATCTTTGCCTTTAGGAGGCATGGATTATGCAGATCCAAAGAAGAAGAGCAATTTTGTGGGTAAA
ATTCTTATGGCTGCTGTTTTGACAGCACTATGCATTCTTATGATCAAGCAGTCCCCAAATTTTAGCACCCCAAGCGTGTTCTCTCGTCAT
GAACCAGGCGTCACTCATGTCTTAGTCACTGGAGGTGCTGGCTATATTGGCTCCCATGCAGCATTACGTCTTCTAAAAGAGTCTTACCGT
GTAACCATAGTGGACAACCXX\
Edits in Original Sequence 
(5')XXAAGAACTCAGCAAAGGTCTAATAGATCTTTGCCTTTAGGAGGCATGGATTATGCAGATCCAAAGAAGAAGAGCAATTTTGTGGG
TAAAATTCTTATGGCTGCTGTTTTGACAGCACTATGCATTCTTATGATCAAGCAGTCCCCAAATTTTAGCACCCCAAGCGTGTTCTCTCG
TCATGAACCAGGCGTCACTCATGTCTTAGTCACTGGAGGTGCTGGCTATATTGGCTCCCATGCAGCATTACGTCTTCTAAAAGAGTCTTA
CCGTGTAACCATAGTGGACAACCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan