ESTScan Details for Unigene SGN-U211930

Score 
327
Direction 
Forward
Predicted Peptide Sequence 
KEKEDGGGGENKEKASSSEKKEGEPKAEGSKSAETKAEVSKLEYHGYNPQTYYAMPMYNQSYMNQDYGVTVYDHGYNAHHTGYVMEYGHQ
QSYVPPSPPPTYLNNTPQMFSDENPDGCSVM
Predicted Coding Sequence 
XAGAAAGAGAAAGAAGACGGTGGTGGCGGAGAAAATAAGGAGAAAGCGAGCAGCAGTGAGAAGAAAGAGGGTGAACCAAAAGCCGAAGGA
AGTAAAAGTGCGGAGACAAAGGCCGAAGTGAGCAAATTGGAATACCATGGTTACAATCCACAAACATATTATGCAATGCCAATGTACAAT
CAAAGTTACATGAACCAAGACTATGGTGTGACGGTGTACGATCATGGTTACAATGCTCATCACACGGGCTACGTCATGGAGTATGGCCAC
CAACAATCATATGTACCACCTTCTCCGCCACCAACATACTTGAACAACACACCTCAAATGTTCAGTGATGAAAACCCTGATGGTTGTTCA
GTCATGTGA\
Edits in Original Sequence 
(5')XAGAAAGAGAAAGAAGACGGTGGTGGCGGAGAAAATAAGGAGAAAGCGAGCAGCAGTGAGAAGAAAGAGGGTGAACCAAAAGCCGA
AGGAAGTAAAAGTGCGGAGACAAAGGCCGAAGTGAGCAAATTGGAATACCATGGTTACAATCCACAAACATATTATGCAATGCCAATGTA
CAATCAAAGTTACATGAACCAAGACTATGGTGTGACGGTGTACGATCATGGTTACAATGCTCATCACACGGGCTACGTCATGGAGTATGG
CCACCAACAATCATATGTACCACCTTCTCCGCCACCAACATACTTGAACAACACACCTCAAATGTTCAGTGATGAAAACCCTGATGGTTG
TTCAGTCATGTGA\(3')TTAAGACAACCTACATTATCATTGAGGGAGAGAGTTCAAGTAAAATTGTAAATAGATTATATACATGGTCTC
GAGGGAATGTCTCAGTAACTAAGTGGACACAGTGAATTGTACTGTACGAGTTTGATGAGAAGTTTTCCCTGTTCTGTATTTCACGTGAGA
AAAAAAAAATCACATATAAAGAGACTTTAAAAAAAATCATGAAATGTAAACGAAATGGTATATATGAGGACATAGTTTCCTTTTTGGAAA
TGTCAATTAGGTTAGAGAGGACTGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan