ESTScan Details for Unigene SGN-U212014

Score 
255
Direction 
Forward
Predicted Peptide Sequence 
LDPASRNTLWTVVNNARNGXSDNSHYPSMEEADYLCDRLGILVDGSLHCIGNSAALMARYGGSYVFAVTTSSANEVEVENMVRHLCPHAN
KVYHLSGTQKFELPNHEVKIADVFQLVENAKINLQMMLEXLADTTLYDVVIKVALTAQAYKMDEIAASIQH
Predicted Coding Sequence 
CTTGATCCAGCTTCAAGAAATACCTTGTGGACTGTTGTGAACAATGCAAGGAATGGCTGXAGCGATAATTCTCACTACCCTTCAATGGAA
GAAGCAGATTATTTATGTGATCGATTAGGAATTCTCGTTGATGGAAGCTTGCACTGCATAGGAAATTCTGCAGCGCTGATGGCTAGATAT
GGAGGGTCGTATGTGTTTGCCGTGACTACATCATCTGCTAATGAGGTGGAAGTGGAAAACATGGTGCGACACCTGTGTCCACATGCCAAT
AAGGTATACCATTTATCGGGGACACAGAAGTTCGAGTTACCAAATCATGAAGTAAAAATTGCAGATGTATTTCAACTTGTTGAGAATGCA
AAGATTAATTTACAGATGATGCTTGAGGXTCTTGCTGATACAACTCTATACGATGTTGTTATCAAGGTTGCTCTTACTGCTCAGGCTTAT
AAGATGGATGAAATTGCAGCTAGCATTCAGCATTAA\
Edits in Original Sequence 
(5')CTTGATCCAGCTTCAAGAAATACCTTGTGGACTGTTGTGAACAATGCAAGGAATGGCTGXAGCGATAATTCTCACTACCCaTTCAA
TGGAAGAAGCAGATTATTTATGTGATCGATTAGGAATTCTCGTTGATGGAAGCTTGCACTGCATAGGAAATTCTGCAGCGCTGATGGCTA
GATATGGAGGGTCGTATGTGTTTGCCGTGACTACATCATCTGCTAATGAGGTGGAAGTGGAAAACATGGTGCGACACCTGTGTCCACATG
CCAATAAGGTATACCATTTATCGGGGACACAGAAGTTCGAGTTACCAAATCATGAAGTAAAAATTGCAGATGTATTTCAACTTGTTGAGA
ATGCAAAGAgTTAATTTACAGATGATGCTTGAGGXTCTTGCTGATACAACTCTATACGATGTTGTTATCAAGGTTGCTCTTACTGCTCAG
GCTTATAAcGATGGATGAAATTGCAGCTAGCATTCAGCATTAA\(3')CAACATA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan