Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U212031

Score 
360
Direction 
Forward
Predicted Peptide Sequence 
QFKQGHLLSGSDDAQICLWDINATPKNKTLDAMQIFKIHEGVVEDVAWHLRHEYLFGSVGDDQYLHIWDLRTPSVTKPIQSVVAHQSEVN
CLAFNPFNEWVVATGSTDKTVKLFDLXQDFNCTAYLGLSQGGGFPGGWNPKNETILASCCLGRRLMVWDLSRIDEEQTPEDAEDGPPELL
FIHGGHTSKISDF
Predicted Coding Sequence 
XGTCAATTTAAGCAGGGTCATTTATTGAGTGGTTCAGATGATGCTCAGATATGTTTATGGGACATCAATGCCACTCCCAAAAATAAGACT
CTAGATGCTATGCAAATATTTAAGATTCATGAAGGCGTCGTAGAGGATGTAGCATGGCATCTGAGGCATGAGTATTTATTTGGCTCTGTT
GGGGATGATCAGTATCTGCATATATGGGATCTGCGGACTCCATCAGTGACCAAGCCTATTCAATCTGTAGTAGCTCATCAAAGCGAGGTT
AATTGTTTAGCTTTCAACCCCTTCAACGAATGGGTTGTAGCAACAGGATCTACAGACAAGACTGTTAAATTATTTGATCTGCXGCAAGAT
TTCAACTGCACTGCATACCTTGGATTGTCACAAGGAGGAGGTTTTCCAGGTGGCTGGAATCCAAAGAATGAAACTATCTTAGCTTCTTGT
TGCCTTGGTAGGAGACTCATGGTTTGGGATCTTAGCAGGATCGATGAAGAACAAACACCAGAAGATGCAGAAGATGGGCCACCTGAGTTG
CTCTTTATTCATGGTGGCCATACAAGTAAAATATCTGACTTC\
Edits in Original Sequence 
(5')XGTCAATTTAAGCAGGGTCATTTATTGAGTGGTTCAGATGATGCTCAGATATGTTTATGGGACATCAATGCCACTCCCAAAAATAA
GACTCTAGATGCTATGCAAATATTTAAGATTCATGAAGGCGTCGTAGAGGATGTAGCATGGCATCTGAGGCATGAGTATTTATTTGGCTC
TGTTGGGGATGATCAGTATCTGCATATATGGGATCTGCGGACTCCATCAGTGACCAAGCCTATTCAATCTGTAGTAGCTCATCAAAGCGA
GGTTAATTGTTTAGCTTTCAACCCCTTCAACGAATGGGTTGTAGCAACAGGATCTACAGACAAGACTGTTAAATTATTTGATCTGCXGCA
AGATTTCAACTGCACTGCATACCTTGGATTGTCACAAGGAGGAGGTTTTCCAGGTcGGCTGGAATCCAAAGAATGAAACTATCTTAGCTT
CTTGTTGCCTTGGTAGGAGACTCATGGTTTGGGATCTTAGCAGGATCGATGAAGAACAAACACCAGAAGATGCAGAAGATGGGCCACCTG
AGTTGCTCTTTATTCATGGTGGCCATACAAGTAAAATATCTGACTTC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan