ESTScan Details for Unigene SGN-U212049

Score 
271
Direction 
Forward
Predicted Peptide Sequence 
EDEXKIIKEFKEGLTQVLISTDLXARGFDQSQVNLVVNYDLPVRHEAPSEPDHEVYLHRIGRAGRFGRKGAIFNLLCDERDNMLMSKIEN
HFNSQVTEIASWRSDEDFENALKKAGLPKTGVINLLHLLVGDLRRRIHSVDHIHRDVASLA
Predicted Coding Sequence 
GAAGACGAGXACAAGATTATCAAAGAGTTCAAAGAAGGGTTGACTCAAGTTCTAATATCAACTGATCTTXCTGCTCGTGGATTTGACCAA
TCGCAGGTTAATTTGGTTGTTAATTATGATCTTCCTGTCAGACATGAGGCTCCATCAGAGCCAGATCATGAGGTATACTTGCATCGGATT
GGTAGAGCTGGACGTTTTGGCCGCAAAGGTGCCATATTCAACTTGCTCTGTGATGAGCGAGACAACATGCTAATGTCAAAGATTGAGAAC
CATTTCAACAGTCAAGTGACCGAGATTGCCTCATGGAGGAGCGATGAAGATTTTGAGAATGCTTTGAAGAAAGCTGGCTTGCCTAAAACT
GGTGTAATCAATCTTCTGCATTTGTTGGTCGGAGATCTCAGGAGAAGGATACACTCCGTAGATCATATTCATAGAGATGTTGCCTCATTA
GCC\
Edits in Original Sequence 
(5')GAAGACGAGXACAAGATTATCAAAGAGTTCAAAGAAGGGTTGACTCAAGTTCTAATATCAACTGATCTTXCTGCTCGTGGATTTGA
CCAATCGCAGGTTAATTTGGTTGTTAATTATGATCTTCCTGTCAGACATGAGGCTCCATCAGAGCCAGATCATGAGGTATACTTGCATCG
GATTGGTAGAGCTGGACGTTTTGGCCGCAAAGGTGCCATATTCAACTTGCTCTGTGATGAGCGAGACAACATGCTAATGTCAAAGATTGA
GAACCATTTCAACAGTCAAGTGACCGAGATTGCCTCATGGAGGAGCGATGAAGATTTTGAGAATGCTTTGAAGAAAGCTGGCTTGCtCTA
AAACTGGTGTAATCAATCTTCTGCATTTGTTGGTCGGAGATCTCAGGAGAAGGATACACTCCGTAGATCATATTCATAGAGATGTTGCCT
CATTAGCC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan