ESTScan Details for Unigene SGN-U212074

Score 
160
Direction 
Forward
Predicted Peptide Sequence 
QPTIITDVISMEIWKEEXMDPSLCQTLTEEXAIATMTPSMVGAAIVKRSERCDVHKGFSVGCLITAQAMLWQPPWGGKKRSGFGRELGEW
SLENYLNIKQVTQYASDEPWAFYKSPSKLESDQAIAGVVPVMRTNAKGSERXSRQMELDVHLMLFVLFVSKSNKSVEEKHGRHIFADISS
VLX
Predicted Coding Sequence 
XTTCAACCAACAATTATAACTGATGTGATATCCATGGAAATCTGGAAAGAGGAGGXTATGGACCCGTCTTTGTGTCAAACTTTAACTGAG
GAAGXAGCCATTGCTACAATGACACCAAGTATGGTGGGTGCTGCTATTGTCAAAAGATCTGAAAGGTGTGACGTTCACAAAGGCTTTTCA
GTCGGATGTCTGATCACTGCTCAAGCCATGCTTTGGCAACCTCCATGGGGAGGTAAAAAGCGTAGTGGTTTTGGACGCGAACTTGGGGAA
TGGAGTCTTGAGAACTACTTAAATATTAAGCAGGTGACTCAGTATGCATCTGACGAACCATGGGCTTTTTACAAGTCACCTTCAAAGCTT
GAAAGTGATCAAGCAATTGCAGGAGTTGTGCCAGTTATGAGAACCAATGCCAAGGGAAGTGAACGATGAAGCAGACAGATGGAACTTGAT
GTACACTTAATGTTGTTTGTATTGTTCGTTAGCAAGTCTAATAAATCTGTTGAAGAGAAACATGGACGGCATATTTTTGCTGATATATCC
TCTGTTCTTCAX\
Edits in Original Sequence 
(5')XTTCAACCAACAATTATAACTGATGTGATATCCATGGAAATCTGGAAAGAGGAGGXTATGGACCCGTCTTTGTGTCAAACTTTAAC
TGAGGAAGXAGCCATTGCTACAATGACACCAAGTATGGTGGGTGCTGCTATTGTCAAAAGATCTGAAAGGTGTGACGTTCACAAAGGCTT
TTCAGTCGGATGTCTGATCACTGCTCAcAGCCATGCTTTGGCAACCTCCATGGGGAGGTAAAAAGCGTAGTGGTTTTGGACGCGAACTTG
GGGAATGGAGTCTTGAGAACTACTTAAATATTAAGCAGGTGACTCAGTATGCATCTGACGAACCATGGGCTTTTTACAAGTCACCTTCAA
AGCTgTGAAAGTGATCAAGCAATTGCAGtGAGTTGTGCCAGTTATGAGAACCAATGCCAAGGGAAGTGAACGATGAAGCAGACAGATGGA
ACTTGATGTACACTTAATGTTGTTTGTATTGTTCGTTAGCAAGTCTAATAAATCTGTTcGAAGAGAAACATGGACGGCATATTTTTGCTG
ATATATCCTCTGTTCTTCAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan