ESTScan Details for Unigene SGN-U212088

Score 
431
Direction 
Forward
Predicted Peptide Sequence 
MSWWWSGAIGAAKKKNELVDDAPLNYQSVALIIGVTGIVGNSLAEILPFSDTPGGPWKVYGVARRPRPSWHVDNPIEYIQCDILNQEDTH
SKLSVLDDVTHVFYVTWASRSTEIENCEVNGKMFKNVLNVVIPSCPNLSHICLQTGRKHYHGPFESFGDTNIAHDTPHHEGX
Predicted Coding Sequence 
ATGAGCTGGTGGTGGTCTGGAGCTATTGGTGCTGCCAAGAAAAAAAACGAACTAGTAGATGATGCACCACTCAACTACCAAAGTGTTGCT
CTAATCATTGGAGTCACCGGCATAGTTGGCAATAGTCTCGCCGAGATTCTCCCTTTCTCCGACACTCCTGGTGGTCCTTGGAAGGTCTAC
GGTGTTGCCCGTCGCCCTAGACCGTCGTGGCACGTTGACAACCCCATTGAGTACATACAGTGTGACATATTGAACCAAGAAGATACACAC
TCTAAACTATCTGTTCTTGATGATGTTACACATGTTTTCTACGTTACATGGGCTAGTCGATCTACGGAGATCGAAAATTGTGAAGTCAAT
GGAAAAATGTTCAAGAATGTGCTTAATGTTGTTATTCCAAGTTGTCCTAACTTGTCACATATTTGCTTACAAACGGGTAGAAAACACTAC
CATGGTCCATTTGAATCATTTGGAGACACTAATATAGCTCATGATACACCACATCATGAGGGTTNG\
Edits in Original Sequence 
CACAAACGCATAGTCTCTTAAGTTTCCTCCAATAACTCATCTCATCCTCAACTTAGCTATAGCTATAGCTTCCAAAAC(5')ATGAGCTG
GTGGTGGTCTGGAGCTATTGGTGCTGCCAAGAAAAAAAACGAACTAGTAGATGATGCACCACTCAACTACCAAAGTGTTGCTCTAATCAT
TGGAGTCACCGGCATAGTTGGCAATAGTCTCGCCGAGATTCTCCCTTTCTCCGACACTCCTGGTGGTCCTTGGAAGGTCTACGGTGTTGC
CCGTCGCCCTAGACCGTCGTGGCACGTTGACAACCCCATTGAGTACATACAGTGTGACATATTGAACCAAGAAGATACACACTCTAAACT
ATCTGTTCTTGATGATGTTACACATGTTTTCTACGTTACATGGGCTAGTCGATCTACGGAGATCGAAAATTGTGAAGTCAATGGAAAAAT
GTTCAAGAATGTGCTTAATGTTGTTATTCCAAGTTGTCCTAACTTGTCACATATTTGCTTACAAACGGGTAGAAAACACTACCATGGTCC
ATTTGAATCATTTGGAGACACTAATATAGCTCATGATACACCACATCATGAGGGTTNG\(3')CCTCGTTTACCCACACCAAACTTTTAC
TATACTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan