ESTScan Details for Unigene SGN-U212116

Score 
343
Direction 
Forward
Predicted Peptide Sequence 
FRMFTQFHNFMEIEYLPVVSPHENQKENAVRFAQRTGEAIATALNVVQTSHSYGDVLLLAKALEANQDPSLYLVEMAGLEAAFHLSSLEA
VDFLDVFLSMNPDSRGQVEIHDFLKVLRLKRCTVSEEIFGFIDVQKIGKITFKQFLVGSAHVLKQPLFHQACESAFTACDSDEKNYIMEQ
E
Predicted Coding Sequence 
XXGTTTAGAATGTTTACACAGTTCCACAATTTTATGGAGATTGAGTACCTTCCTGTTGTATCGCCTCACGAGAATCAGAAAGAAAATGCT
GTACGTTTTGCTCAAAGGACTGGCGAAGCTATTGCAACTGCCCTTAACGTTGTCCAAACATCTCATTCTTATGGTGATGTACTACTGCTT
GCTAAGGCGTTGGAGGCCAATCAGGATCCCTCGCTCTATTTGGTTGAGATGGCAGGGCTTGAAGCGGCGTTTCATTTAAGCTCTTTGGAG
GCTGTAGATTTTCTGGATGTTTTCCTTTCAATGAACCCAGACTCCAGGGGACAGGTTGAGATTCATGACTTCCTCAAGGTTCTAAGACTG
AAACGCTGTACTGTTTCTGAAGAGATTTTTGGCTTCATCGACGTGCAAAAGATCGGTAAAATAACATTCAAGCAGTTTTTGGTTGGGTCA
GCTCATGTCTTGAAGCAGCCATTATTTCATCAAGCCTGTGAATCAGCATTTACTGCATGTGATAGTGATGAGAAGAACTACATTATGGAG
CAAGAG\
Edits in Original Sequence 
(5')XXGTTTAGAATGTTTACACAGTTCCACAATTTTATGGAGATTGAGTACCTTCCTGTTGTATCGCCTCACGAGAATCAGAAAGAAAA
TGCTGTACGTTTTGCTCAAAGGACTGGCGAAGCTATTGCAACTGCCCTTAACGTTGTCCAAACATCTCATTCTTATGGTGATGTACTACT
GCTTGCTAAGGCGTTGGAGGCCAATCAGGATCCCTCGCTCTATTTGGTTGAGATGGCAGGGCTTGAAGCGGCGTTTCATTTAAGCTCTTT
GGAGGCTGTAGATTTTCTGGATGTTTTCCTTTCAATGAACCCAGACTCCAGGGGACAGGTTGAGATTCATGACTTCCTCAAGGTTCTAAG
ACTGAAACGCTGTACTGTTTCTGAAGAGATTTTTGGCTTCATCGACGTGCAAAAGATCGGTAAAATAACATTCAAGCAGTTTTTGGTTGG
GTCAGCTCATGTCTTGAAGCAGCCATTATTTCATCAAGCCTGTGAATCAGCATTTACTGCATGTGATAGTGATGAGAAGAACTACATTAT
GGAGCAAGAG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan