Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U212253

Score 
240
Direction 
Forward
Predicted Peptide Sequence 
MGLWDSLLNWLRSLFFKQEMELSLVGLQNAGKTSLVNAIATGGYSEDMIPTVGFNMRKVTKGNXDHKTLGPWRPKEISYDVGALLSGVSA
ILYVVDAADRDSVPITRTELDELLKKPSLSGIPLLILGNKVDKSEALSKQALVDQLGLDSLTDREVCCYMISCKDSVNIDAVIDXANKAL
KDGKIRSGSRLLTSSRGGYGNLENECSX
Predicted Coding Sequence 
ATGGGTCTTTGGGATTCCTTACTCAACTGGCTTCGCAGTCTATTCTTTAAACAGGAAATGGAACTTTCTCTGGTAGGCCTACAAAATGCG
GGGAAGACATCTCTTGTGAATGCCATTGCTACTGGAGGCTACAGCGAGGACATGATTCCGACGGTTGGCTTTAATATGCGTAAAGTTACA
AAAGGAAATGXTGACCATAAAACTCTGGGACCTTGGAGGCCAAAGGAGATTTCGTACGATGTGGGAGCGCTACTGTCTGGTGTCTCTGCA
ATATTGTATGTTGTTGATGCTGCTGATAGAGACAGTGTACCTATAACCCGAACCGAGTTAGATGAACTTTTGAAGAAACCTTCACTAAGT
GGGATACCTTTGCTTATCCTGGGAAACAAAGTTGACAAATCAGAAGCTCTTTCAAAGCAAGCATTGGTCGATCAACTAGGTCTTGATTCA
TTAACAGATAGAGAAGTGTGCTGCTACATGATCTCGTGCAAGGATTCTGTAAATATTGATGCTGTTATTGATXTGGCTAATAAAGCACTC
AAAGACGGCAAAATAAGGAGTGGTTCCAGACTTCTCACCTCCTCTCGTGGAGGATATGGTAATCTGGAAAATGAATGTAGTCXX\
Edits in Original Sequence 
CAAAGTTCATTGCTTTTTCACTTTTCCAAC(5')ATGGGTCTTTGGGATTCCTTACTCAACTGGCTTCGCAGTCTATTCTTTAAACAGGA
AATGGAACTTTCTCTGGTAGGCCTACAAAATGCGGGGAAGACATCTCTTGTGAATGCCATTGCTACTGGAGGCTACAGCGAGGACATGAT
TCCGACGGTTGGCTTTAATATGCGTAAAGTTACAAAAGGAAATGXTGACCATAAAACTCTGGGACCTTGGAGGCCAAAGGAGATTTCGTA
CGATGTGGGAGCGCTACTGTCgTGGTGTCTCTGCAATATTGTATGTTGTTGATGCTGCTGATAGAGACAGTGTACCTATAACCCGAACCG
AGTTAGATGAACTTTTGAAGAAACCTTCACTAAGTGGGATACCTTTGCTTATCCTGGGAAACAAAGTTGACAAATCAGAAGCTCTTTCAA
AGCAAGCATTGGTCGATCAACTAGGTCTTGATTCATTAACAGATAGAGAAGTGTGCTGCTACATGATCTCGTGCAAGGATTCTGTAAATA
TTGATGCTGTTATTGATXTGGCTAATAAAGCACTCAAAGACGGCAAAATAAGGAGTGGTTCCAGACTTCTCACCTCCTCTCGTGGAGGAT
ATGGTAATCTGGAAAATaGAATGTAGTCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan