ESTScan Details for Unigene SGN-U212368

Score 
293
Direction 
Forward
Predicted Peptide Sequence 
YDEYYSANASGAAFCRSAALILMALLLLRHALPMTDTDGDDEDPTAVFSLFFFGQLASFYPATSCSGPSAFCSSAXQREEAAALAATQFA
VVLHSGQSRGVQFTIASAAPATPAAQAAVPASLDNVXNDKNCCVQAYLFQLWEVKQCTX
Predicted Coding Sequence 
XATTATGATGAATACTATTCTGCAAACGCAAGTGGTGCAGCATTCTGCCGATCTGCTGCTTTAATTTTGATGGCTCTTTTACTCTTGCGC
CATGCATTACCTATGACAGACACGGATGGAGATGATGAAGATCCAACTGCTGTCTTTTCGCTTTTCTTCTTCGGGCAGTTGGCTTCCTTT
TACCCTGCTACATCATGCTCTGGGCCATCAGCATTTTGCAGCAGCGCAGXGCAGAGAGAAGAGGCTGCAGCATTGGCCGCAACACAATTT
GCAGTTGTGTTACACTCTGGACAGTCAAGAGGTGTACAGTTTACCATAGCATCAGCTGCGCCAGCTACACCAGCTGCACAGGCTGCTGTG
CCTGCATCATTGGATAATGTTXTAAACGATAAGAACTGTTGCGTGCAAGCATATCTGTTCCAGTTGTGGGAGGTTAAGCAATGTACTCAX
\
Edits in Original Sequence 
(5')XATTATGATGAATACTATTCTGCAAACGCAAGTGGTGCAGCATTCTGCCGATCTGCTGCTTTAATTTTGATGGCTCTTTTACTCTT
GCGCCATGCATTACCTATGACAGACACGGATGGAGATGATGAAGATCCAACTGCTGTCTTTTCGCTTTTCTTgCTTCGGGCAGTTGGCTT
CCTTTTACCCTGCTACATCATGCTCTGGGCCATCAGCATTTTGCAGCAGCGCAGXGCAGAGAGAAGAGGCTGCAGCATTGGCCGCAACAC
AATTTGCAGTTGTGTTACACTCTGGACAGTCAAGAGGTGTACAGTTTACCATAGCATCAGCTGCGCCAGCTACACCAGCTGCACAGGCTG
CTGTGCCTGCATCATTGGATAATGTTXTAAACGATAAGAACTGTTGCGTGCAAGCATATCTGTTCCAGTTGTGGGAGGTTAAGCAATGTA
CTCAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan