ESTScan Details for Unigene SGN-U212478

Score 
162
Direction 
Forward
Predicted Peptide Sequence 
MVMDLLDKMMVPMRKVWTKVATRLRIRKTAWNIAAVGKLVWLLAEDKELLWVKWVHGIYMKQNSDVWGHVPPREAAGIGGDYIXIKENMR
DWFVQGKYNLTPTGDYSITSSYNAMLSXPVQDGSLTPDLVLSGPPKHRVTMWLAVQGKLLTQDRLVRMNX
Predicted Coding Sequence 
ATGGTTATGGATTTGTTGGACAAGATGATGGTTCCTATGCGCAAAGTATGGACTAAAGTCGCTACACGTCTTCGCATTCGTAAAACTGCG
TGGAATATTGCAGCAGTTGGCAAGCTAGTGTGGCTACTCGCTGAAGACAAGGAACTGTTATGGGTGAAATGGGTTCATGGGATTTACATG
AAGCAGAATTCGGATGTTTGGGGGCATGTTCCACCTAGAGAAGCAGCTGGTATTGGAGGAGATTACATTXCAATCAAGGAAAACATGAGA
GATTGGTTTGTCCAGGGGAAGTATAACTTGACCCCCACAGGTGACTATTCTATTACAAGTAGCTATAATGCAATGCTGAGTAAXCCAGTG
CAGGATGGAAGTCTCACACCTGATTTGGTGCTCAGTGGCCCTCCCAAGCATAGAGTTACAATGTGGCTAGCAGTTCAAGGAAAGCTTCTA
ACACAGGACAGGCTGGTGAGAATGAATAXX\
Edits in Original Sequence 
CTTGTCCAATTCCTGTTTCTTCCTTTCAGGACAATTTATATAAAGGAAGGAAAAAGGAAGATTTTGGTTTAGAGATTCATCAGAATAA(5')
ATGGTTATGGATTTGTTGGACAAGATGATGGTTCCTATGCGCAAAGTATGGACTAAAGTCGCTACACGTCTTCGCATTCGTAAAACTG
CGTGGAATATTGCAGCAGTTGGCAAGCTAGTGTGGCTACTCGCTGAAGACAAGGAACTGTTATGGGTGAAATGGGTTCATGGGATTTACA
TGAAGCAGAATTCGGATGTTTGGGGGCATGTTCCACCTAGAGAtAGCAGCTGGTATTGGAGGAGATTACATTXCAATCAAGGAAAACATG
AGAGATTGGTTTGTCCAGGGGAAGTATAACTTGACCCCCACAGGTGACTATTCTATTACAAGTAGCTATAATGCAATGCTGAGTAAXCCA
GTGCAGGATGGAAGTCTCACACCTGATTTGGTGCTCAGTGGCCCTaCCCAAGCATAGAGTTACAATGTGGCTAGCAGTTCAAGGAAAGCT
TCTAACACAGGACAGGCTGGTGAGAATGAATAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan