ESTScan Details for Unigene SGN-U212782

Score 
254
Direction 
Forward
Predicted Peptide Sequence 
MLNSTVEIFEQRFMTGAGKNLPEHAMICMINREESVMSELCLDAPAVDDPDKLFANTLFEVVFNESRNLPFILFVKDADKVMAGNAELYS
TFKTRLEKLLNNVIIIGSQWLEKLPDNVISIGSXIAEKLSDNVIIIGFNWLEKLPDNVITIGSQSAEKLPDNVITIVHSRLEKLPDNVIS
IGSQSA
Predicted Coding Sequence 
ATGCTGAATTCAACAGTGGAGATTTTTGAGCAACGTTTTATGACTGGTGCGGGCAAAAACCTTCCTGAACATGCAATGATTTGCATGATA
AATCGTGAAGAGTCAGTCATGAGCGAGCTGTGCTTAGACGCCCCTGCCGTGGATGATCCGGACAAGTTATTCGCTAATACATTGTTTGAG
GTTGTATTCAATGAGAGCCGGAATTTGCCATTCATTTTGTTCGTGAAAGATGCTGACAAAGTAATGGCAGGAAACGCAGAATTATATTCA
ACATTTAAAACTCGGCTTGAGAAACTTCTTAATAATGTAATTATTATTGGTTCACAGTGGCTTGAGAAGCTTCCTGATAATGTAATTAGT
ATTGGTTCAXCAATAGCTGAGAAGCTTTCTGATAATGTAATTATTATTGGTTTCAATTGGCTTGAGAAGCTTCCTGATAATGTAATTACT
ATTGGTTCACAGTCTGCTGAGAAGCTTCCTGATAATGTAATTACTATTGTTCACAGTCGGCTTGAGAAGCTTCCTGATAATGTAATTTCT
ATTGGTTCACAGTCGGCTTGA\
Edits in Original Sequence 
TTTTTTTTTAACAAGAAACAAGTGCAACAAACATTGTATTTAAATCAATAATACTATACAATATAATACAATACAACACAACACACAAGA
CAATACAATACAATACTCTTTATTTGGAACAAAGAGTTTATTTGGTTGGGAATAACAAGTAACACAAGCACAACAAACTGATTGAATAAT
AAGTTCTATATAGACACACTGTTGGGAATGAAACAATTCCGTCCACTGCA
(5')ATGCTGAATTCAACAGTGGAGATTTTTGAGCAACGT
TTTATGACTGGTGCGGGCAAAAACCTTCCTGAACATGCAATGATTTGCATGATAAATCGTGAAGAGTCAGTCATGAGCGAGCTGTGCTTA
GACGCCCCTGCCGTGGATGATCCGGACAAGTTATTCGCTAATACATTGTTTGAGGTTGTATTCAATGAGAGCCGGAATTTGCCATTCATT
TTGTTCGTGAAAGATGCTGACAAAGTAATGGCAGGAAACGCAGAATTATATTCAACATTTAAAACTCGGCTTGAGAAACTTCTTAATAAT
GTAATTATTATTGGTTCACAGTcGGCTTGAGAAGCTTCCTGATAATGTAATTAGTATTGGTTCAXCAATAGCtTGAGAAGCTTTCTGATA
ATGTAATTATTATTGGTTTaCAATTGGCTTGAGAAGCTTCCTGATAATGTAATTACTATTGGTTCACAGTCTGCtTGAGAAGCTTCCTGA
TAATGTAATTACTATaTGTTCACAGTCGGCTTGAGAAGCTTCCTGATAATGTAATTTCTATTGGTTCACAGTCGGCTTGA\(3')AAGCT
TCCCGATATGTAATTACTAATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan