ESTScan Details for Unigene SGN-U212787

Score 
1667
Direction 
Forward
Predicted Peptide Sequence 
MEASAGVLRRFPSVTGAGVGVSSNPLNRSCSVSRVSLKSMGCGFYDEGCLEYYSSGRGGIIRCGKKKNKEKDMAELKKTKKKMKLLKGLT
KNLSNLNGMGLGFGCDVDLVDQVQGKTISEAAELLLGQLQQLKAEEKELKRKRKEEKAQMKMKVAASEVQSNTRSCAMSSSSSSSSESSD
SSDDECQNLVDMKSLKIGTLAQTIPEACDRALDNATLNPSLSTPEVDTTVEISSMPSTTTEESTGKTTSFEFSVPEQKGECCLEASDCHI
GNVGSSITPGTRSNVSSIAAATTTTAEGTKRIEVCMGGKCKRLGAGALLEEFQRVAGIEAAVSGCKCMGKCKVGPNVKVSGCSSSSISDA
FQAGDSVAVSSAPTTSNSLCIGVGLEDVSLIAANLLGRYQEEAWPMLCLKSFFLSLAXIVGRFFWDFGNEFESFFXNVNISNIEKFAKKK
KIIIIYRYGPFVSLKYPDLDEEYREVMRDFAKRLEKLAEELLDLLCENLGLEKGYLKNAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAH
TDAGGIILLFQDDKVSGLQLLKDEQWIDVPPMRHSIVVNLGDQLEVQDSLSVCVFXHYNLEVVTKNGINEXVKKQVITNGKYKSVLHRVI
AQTDGTRMSLASFYNPGSDAVIYPAKTLVEKEAEESTQVYPKFVFDDYMKLYAGLKFQAKEPRFEAMKAMESDPIASA
Predicted Coding Sequence 
ATGGAAGCCTCTGCCGGAGTTTTACGCCGATTTCCTTCAGTCACCGGCGCCGGTGTCGGAGTTAGCAGCAATCCGTTGAATCGTAGTTGT
AGTGTTTCACGTGTTAGTTTGAAATCAATGGGTTGTGGGTTTTACGATGAGGGTTGTTTGGAGTATTATTCATCTGGTAGAGGTGGAATT
ATTAGGTGTGGGAAGAAGAAGAACAAAGAGAAGGATATGGCGGAGTTGAAGAAAACGAAGAAGAAGATGAAATTACTTAAGGGTTTGACG
AAGAATTTGTCGAATTTGAATGGGATGGGATTAGGGTTCGGTTGTGATGTTGATTTGGTTGATCAAGTTCAAGGGAAGACAATTTCGGAG
GCGGCGGAGCTATTGTTGGGACAGCTTCAACAGTTGAAGGCAGAGGAGAAGGAGTTGAAGAGGAAAAGAAAAGAAGAAAAAGCACAAATG
AAGATGAAAGTAGCAGCAAGTGAAGTGCAGAGCAACACAAGGAGCTGTGCAATGTCATCATCTTCAAGCTCGTCTTCAGAATCGAGTGAT
TCAAGTGATGATGAATGTCAAAATTTGGTTGACATGAAAAGCCTGAAAATCGGAACACTTGCTCAAACAATTCCTGAAGCGTGTGATCGA
GCACTTGATAATGCAACACTAAACCCTTCCCTTTCAACTCCAGAAGTCGATACAACAGTAGAGATCTCAAGCATGCCATCAACTACCACG
GAGGAATCAACTGGGAAGACGACAAGTTTTGAGTTTTCAGTCCCTGAACAAAAAGGCGAATGCTGCTTGGAAGCTAGTGATTGTCACATT
GGCAATGTAGGCAGCAGTATCACACCAGGCACTAGGTCTAATGTATCATCTATAGCAGCAGCTACAACGACAACAGCAGAGGGTACAAAG
AGAATCGAAGTATGTATGGGTGGTAAATGCAAGCGATTGGGCGCTGGAGCGTTACTAGAAGAATTCCAACGCGTTGCTGGGATTGAAGCT
GCAGTCTCTGGTTGCAAATGCATGGGAAAGTGTAAAGTTGGTCCTAATGTCAAAGTTTCAGGGTGTAGCAGCAGCAGCATCTCGGACGCC
TTCCAAGCCGGTGACTCGGTTGCTGTTAGCTCTGCTCCAACTACAAGTAACTCTCTATGTATTGGGGTTGGTTTAGAGGATGTGAGTCTA
ATTGCAGCCAATTTACTTGGCAGATATCAAGAAGAGGCTTGGCCAATGCTTTGCCTTAAATCTTTTTTTCTTTCATTAGCAATXATAGTA
GGTAGGTTTTTTTGGGATTTTGGCAATGAGTTTGAATCTTTTTTTGXTAATGTAAATATCAGCAATATAGAAAAGTTTGCTAAAAAAAAA
AAAATTATCATTATATACAGATATGGACCTTTTGTATCTCTCAAGTACCCXGATCTTGACGAAGAATACAGAGAGGTGATGAGAGATTTT
GCTAAAAGATTGGAGAAATTGGCTGAGGAGTTACTTGACTTACTCTGTGAAAATCTTGGACTTGAAAAAGGTTACTTGAAAAATGCCTTT
TATGGATCAAAAGGTCCCAACTTTGGTACTAAAGTTAGCAACTATCCACCATGTCCTAAGCCCGATTTGATCAAGGGACTCCGCGCTCAT
ACAGACGCAGGAGGCATCATACTTCTGTTCCAAGATGACAAAGTGAGTGGCCTTCAACTCCTCAAAGACGAGCAATGGATCGATGTTCCT
CCCATGCGCCACTCTATTGTGGTTAACCTTGGTGACCAACTTGAGGTACAAGATTCACTAAGTGTGTGTGTTTTTATXCACTATAACTTA
GAAGTAGTAACTAAAAATGGTATTAATGAAXATGTTAAAAAACAGGTGATCACTAACGGGAAGTACAAGAGTGTGCTGCACAGAGTAATT
GCACAAACAGACGGGACACGAATGTCATTAGCCTCATTTTACAATCCAGGAAGTGATGCAGTAATATATCCAGCAAAAACTTTGGTTGAA
AAAGAGGCAGAGGAAAGTACACAAGTGTATCCAAAGTTTGTGTTTGATGATTACATGAAGTTATATGCTGGACTCAAGTTTCAAGCCAAA
GAGCCAAGATTTGAAGCAATGAAGGCAATGGAAAGTGATCCAATTGCAAGTGCTTAG\
Edits in Original Sequence 
AATTCTTGTTCAGTGTAAAGTTGAACAAGAATTTGATCATCCATA(5')ATGGAAGCCTCTGCCGGAGTTTTACGCCGATTTCCTTCAGT
CACCGGCGCCGGTGTCGGAGTTAGCAGCAATCCGTTGAATCGTAGTTGTAGTGTTTCACGTGTTAGTTTGAAATCAATGGGTTGTGGGTT
TTACGATGAGGGTTGTTTGGAGTATTATTCATCTGGTAGAGGTGGAATTATTAGGTGTGGGAAGAAGAAGAACAAAGAGAAGGATATGGC
GGAGTTGAAGAAAACGAAGAAGAAGATGAAATTACTTAAGGGTTTGACGAAGAATTTGTCGAATTTGAATGGGATGGGATTAGGGTTCGG
TTGTGATGTTGATTTGGTTGATCAAGTTCAAGGGAAGACAATTTCGGAGGCGGCGGAGCTATTGTTGGGACAGCTTCAACAGTTGAAGGC
AGAGGAGAAGGAGTTGAAGAGGAAAAGAAAAGAAGAAAAAGCACAAATGAAGATGAAAGTAGCAGCAAGTGAAGTGCAGAGCAACACAAG
GAGCTGTGCAATGTCATCATCTTCAAGCTCGTCTTCAGAATCGAGTGATTCAAGTGATGATGAATGTCAAAATTTGGTTGACATGAAAAG
CCTGAAAATCGGAACACTTGCTCAAACAATTCCTGAAGCGTGTGATCGAGCACTTGATAATGCAACACTAAACCCTTCCCTTTCAACTCC
AGAAGTCGATACAACAGTAGAGATCTCAAGCATGCCATCAACTACCACGGAGGAATCAACTGGGAAGACGACAAGTTTTGAGTTTTCAGT
CCCTGAACAAAAAGGCGAATGCTGCTTGGAAGCTAGTGATTGTCACATTGGCAATGTAGGCAGCAGTATCACACCAGGCACTAGGTCTAA
TGTATCATCTATAGCAGCAGCTACAACGACAACAGCAGAGGGTACAAAGAGAATCGAAGTATGTATGGGTGGTAAATGCAAGCGATTGGG
CGCTGGAGCGTTACTAGAAGAATTCCAACGCGTTGCTGGGATTGAAGCTGCAGTCTCTGGTTGCAAATGCATGGGAAAGTGTAAAGTTGG
TCCTAATGTCAAAGTTTCAGGGTGTAGCAGCAGCAGCATCTCGGACGCCTTCCAAGCCGGTGACTCGGTTGCTGTTAGCTCTGCTCCAAC
TACAAGTAACTCTCTATGTATTGGGGTTGGTTTAGAGGATGTGAGTCTAATTGCAGCCAATTTACTTGGCAGATATCAAGAAGtAGGCTT
GGCCAATGCTTTGCCTTAAATCTTTTTTTCTTTCATTAGCAATXATAGTAGGTAGGTTTTTTTGGGATTTTGGCAATGAGTTTGAATCTT
TTTTTGXTAATGTAAATATCAGCAATATAGAtAAAGTTTGCTAAAAAAAAAAAAATTATCATTATATACAGATATGGACCTTTTGTATCT
CTCAAGTACCCXGATCTTGACGAAGAATACAGAGAGGTGATGAGAGATTTTGCTAAAAGATTGGAGAAATTGGCTGAGGAGTTACTTGAC
TTACTCTGTGAAAATCTTGGACTTGAAAAAGGTTACTTGAAAAATGCCTTTTATGGATCAAAAGGTCCCAACTTTGGTACTAAAGTTAGC
AACTATCCACCATGTCCTAAGCCCGATTTGATCAAGGGACTCCGCGCTCATACAGACGCAGGAGGCATCATACTTCTGTTCCAAGATGAC
AAAGTGAGTGGCCTTCAACTCCTCAAAGACGAGCAATGGATCGATGTTCCTCCCATGCGCCACTCTATTGTGGTTAACCTTGGTGACCAA
CTTGAGGTACAAGATTCACTAAGTGTGTGTGTTTTTATXCACTATAACTTAGAAGTAGTAACTAAAAATGGTATTAATGAAXATGTTAtA
AAAACAGGTGATCACTAACGGGAAGTACAAGAGTGTGCTGCACAGAGTAATTGCACAAACAGACGGGACACGAATGTCATTAGCCTCATT
TTACAATCCAGGAAGTGATGCAGTAATATATCCAGCAAAAACTTTGGTTGAAAAAGAGGCAGAGGAAAGTACACAAGTGTATCCAAAGTT
TGTGTTTGATGATTACATGAAGTTATATGCTGGACTCAAGTTTCAAGCCAAAGAGCCAAGATTTGAAGCAATGAAGGCAATGGAAAGTGA
TCCAATTGCAAGTGCTTAG\(3')ATCCCAATTCAATTAAAAAAATTGGTGTTTGAAAAATATATTTAAATATAGCAATCTATGTATACC
CATTATTTGCTCTTTTTATGTATGGTAGAATAAAGTTAGTATTAAAAAAGATTGTGATTTGCTGCATATGTATCAAAAAGAGTCCTAATA
TTTGTATCTATAAATAAGGTGCCTTCTAGTGAAATTATACAAATAATAATTTGGAGTGTAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan