ESTScan Details for Unigene SGN-U212789

Score 
1127
Direction 
Forward
Predicted Peptide Sequence 
MENFPIINLEKLNGAERVATMEKINDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKCMEQRFKELVAKKGLEGVEVEVTDMDWESTF
FLRHLPSSNISQLPDLDDVYREVMRDFAKRLEKLAEELLDLLCENLGLEKSYLKNTFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDA
GGIILLFQDDKVSGLQLLKDGRWIDVPPMRHSIVVNLGDQLEVITNGKYKSVMHRVIAQKDGTRMSLASFYNPGNDALIYPAPALVDKEA
EEHNKQVYPKFMFDDYMKLYANLKFQAKEPRFEAMKAMESDPIAIA
Predicted Coding Sequence 
ATGGAGAATTTCCCAATTATCAACTTGGAAAAACTCAATGGTGCTGAGAGAGTAGCCACAATGGAAAAGATTAATGATGCTTGTGAAAAT
TGGGGCTTCTTTGAGTTGGTGAACCATGGAATTCCACATGAAGTGATGGACACTGTGGAGAAATTAACAAAGGGACATTACAAGAAGTGT
ATGGAACAAAGATTTAAAGAATTGGTTGCTAAGAAAGGACTTGAAGGTGTTGAAGTTGAGGTTACTGATATGGATTGGGAAAGTACTTTT
TTCTTGAGGCATCTCCCTTCTTCTAATATCTCTCAACTACCTGATCTTGATGATGTATATAGGGAAGTTATGAGGGATTTTGCTAAAAGA
TTAGAGAAGTTAGCAGAAGAACTCTTGGATTTGCTTTGTGAAAACCTTGGACTAGAAAAAAGTTACTTGAAAAATACATTTTATGGCTCA
AAAGGTCCAAATTTTGGGACTAAAGTAAGTAACTATCCACCATGTCCAAAACCTGATCTAATAAAGGGGTTGCGTGCACATACTGATGCT
GGTGGCATAATACTTCTCTTCCAAGATGACAAGGTGAGTGGCCTACAACTCCTCAAAGACGGTCGATGGATCGATGTTCCTCCCATGCGC
CACTCCATCGTGGTTAACCTAGGTGACCAACTCGAGGTAATCACGAACGGGAAGTACAAGAGTGTGATGCATAGAGTGATCGCACAAAAA
GACGGGACTCGGATGTCATTAGCATCCTTCTACAATCCAGGAAATGATGCATTGATCTATCCAGCACCAGCTCTAGTTGATAAAGAGGCA
GAGGAACATAACAAACAAGTTTACCCTAAATTTATGTTTGATGATTACATGAAATTATATGCTAATCTCAAATTTCAAGCCAAAGAGCCA
AGATTTGAAGCCATGAAAGCTATGGAAAGTGATCCAATTGCAATTGCTTAG\
Edits in Original Sequence 
GAAAACTCACTTTCAATATCTTCCATCTTTTTATTCCACACACTATTTACTCTAAAAAAGAAAAAAAAAACATTTTCTTCTATTTCTTCA
AGAAATTAAAA
(5')ATGGAGAATTTCCCAATTATCAACTTGGAAAAACTCAATGGTGCTGAGAGAGTAGCCACAATGGAAAAGATTAAT
GATGCTTGTGAAAATTGGGGCTTCTTTGAGTTGGTGAACCATGGAATTCCACATGAAGTGATGGACACTGTGGAGAAATTAACAAAGGGA
CATTACAAGAAGTGTATGGAACAAAGATTTAAAGAATTGGTTGCTAAGAAAGGACTTGAAGGTGTTGAAGTTGAGGTTACTGATATGGAT
TGGGAAAGTACTTTTTTCTTGAGGCATCTCCCTTCTTCTAATATCTCTCAACTACCTGATCTTGATGATGTATATAGGGAAGTTATGAGG
GATTTTGCTAAAAGATTAGAGAAGTTAGCAGAAGAACTCTTGGATTTGCTTTGTGAAAACCTTGGACTAGAAAAAAGTTACTTGAAAAAT
ACATTTTATGGCTCAAAAGGTCCAAATTTTGGGACTAAAGTAAGTAACTATCCACCATGTCCAAAACCTGATCTAATAAAGGGGTTGCGT
GCACATACTGATGCTGGTGGCATAATACTTCTCTTCCAAGATGACAAGGTGAGTGGCCTACAACTCCTCAAAGACGGTCGATGGATCGAT
GTTCCTCCCATGCGCCACTCCATCGTGGTTAACCTAGGTGACCAACTCGAGGTAATCACGAACGGGAAGTACAAGAGTGTGATGCATAGA
GTGATCGCACAAAAAGACGGGACTCGGATGTCATTAGCATCCTTCTACAATCCAGGAAATGATGCATTGATCTATCCAGCACCAGCTCTA
GTTGATAAAGAGGCAGAGGAACATAACAAACAAGTTTACCCTAAATTTATGTTTGATGATTACATGAAATTATATGCTAATCTCAAATTT
CAAGCCAAAGAGCCAAGATTTGAAGCCATGAAAGCTATGGAAAGTGATCCAATTGCAATTGCTTAG\(3')ATTAAAAATTAAAAAAATT
GGAAGAAAAATTATTTGTTATTGACATACATTATTTGTATTTTTTTTTGAAGTATAGTGGAATTTATATATTTTTATTACAAAGTGTGCG
TCCCTACTACATGTGTGGTAAAGAGGACTAAAGTTTGTATCTTACACATATTTTAATACCCAAAAATGAGATGTGTTTCTGTTTTTCTAA
TTAGTTTTTCCTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAACTCGAACTAGTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan