ESTScan Details for Unigene SGN-U212794

Score 
279
Direction 
Reverse
Predicted Peptide Sequence 
KKWFIPSNLDLYKSSVPAASWRDTIFCYMAPNPPSLQEFPTPCGESLIDFSKDVKKLGFTLLELLSEGLGLDRSYLKDYMDCFHLFCSCN
YYPPCPQPELTMGTIQHTDIGFVTILLQDDMGGLQVLHQNHWVDVPPTPGSXSGEYWRFSAENLFFNYFLQLLSNDKYLSVEHRAISNNV
GSRMSITCFFGESPYQSSKLYGPITELLSEDNPPKYRANHSERPH
Predicted Coding Sequence 
XXAAAAAAGTGGTTTATACCTAGCAATCTTGATTTGTATAAATCTTCTGTTCCAGCTGCAAGTTGGAGAGACACGATTTTCTGTTACATG
GCTCCGAATCCTCCCAGTCTACAAGAATTTCCAACTCCATGCGGGGAGTCATTAATAGACTTCTCCAAGGATGTGAAGAAACTGGGATTC
ACTTTACTTGAATTATTGTCTGAAGGTCTCGGTCTCGATCGTAGTTATCTCAAAGATTATATGGATTGTTTTCATCTTTTCTGTTCTTGC
AACTACTACCCACCATGTCCTCAGCCAGAACTCACCATGGGCACCATTCAACATACCGATATTGGTTTTGTAACGATCCTTCTACAAGAT
GATATGGGAGGGCTCCAAGTTCTTCACCAGAATCATTGGGTTGATGTTCCTCCTACACCCGGTTCTXCTAGTGGTGAATATTGGAGATTT
TCTGCAGAAAATCTTTTTTTTAATTATTTTTTGCAGCTCTTGTCAAATGACAAGTACTTAAGTGTCGAGCACAGAGCAATCTCAAACAAT
GTTGGATCAAGAATGTCAATCACGTGCTTCTTCGGTGAAAGTCCATATCAATCTTCCAAGCTTTATGGACCGATAACTGAATTGTTATCA
GAAGATAATCCTCCAAAATATCGCGCXAACCACAGTGAAAGACCACACTAG\
Edits in Original Sequence 
(5')XXAAAAAAGTGGTTTATACCTAGCAATCTTGATTTGTATAAATCTTCTGTTCCAGCTGCAAGTTGGAGAGACACGATTTTCTGTTA
CATGGCTCCGAATCCTCCCAGTCTACAAGAATTTCCAACTCCATGCGGGGAGTCATTAATAGACTTCTCCAAGGATGTGAAGAAACTGGG
ATTCACTTTACTTGAATTATTGTCTGAAGGTCTCGGTCTCGATCGTAGTTATCTCAAAGATTATATGGATTGTTTTCATCTTTTCTGTTC
TTGCAACTACTACCCACCATGTCCTCAGCCAGAACTCACCATGGGCACCATTCAACATACCGATATTGGTTTTGTAACGATCCTTCTACA
AGATGATATGGGAGGGCTCCAAGTTCTTCACCAGAATCATTGGGTTGATGTTCCTCCTACACCCGGTTCTXCTAGTGGTGAATATTGGAG
ATTTTCTGCAGAAAATCTTTTTTTTAATTATTTTTTGCAGCTCTTGTCAAATGACAAGTACTTAAGTGTCGAGCACAGAGCAATCTCAAA
CAATGTTGGATCAAGAATGTCAATCACGTGCTTCTTCGGTGAAAGTCCATATCAATCTTCCAAGCTTTATGGACCGATAACTGAATTGTT
ATCAGAAGATAATCCTCCAAAATATCGCGCXAACCACAGTGAAAGACCACACTAG\(3')TTACCTCCATAACAGAGGCCTAGATGGAAC
TTCTGCATTGTCCCGTTACAAGATCTAAGAATAAGAATAATAATGTTATCTATTATTACTATTTATACTTCTGCAGATTGTACCTTTGAA
TTTGAAGCAAATGTTTGAGTTAAATACTTTCACGTTTCTAAGCAATGTAATATAATTTATAAAAAAAAAAAAAAAAAAAACCAGACTAGT
T

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan