ESTScan Details for Unigene SGN-U212837

Score 
381
Direction 
Forward
Predicted Peptide Sequence 
DDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTNPEEGKVDAFDEH
G
Predicted Coding Sequence 
XXGGATGACCCAGCTAAGGGGGCAGCCAGTTTCACTGCCCAGGTCATCATCATGAACCATCCTGGCCAGATTGGAAATGGATATGCACCA
GTGCTTGACTGCCACACTTCCCACATTGCTGTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGTTCAGGTAAGGAACTTGAGAAG
GAGCCTAAGTTCTTGAAGAATGGTGATGCTGGTATGGTTAAGATGATTCCCACCAACCCAGAAGAAGGGAAAGTAGATGCATTTGATGAG
CACGGATGA\
Edits in Original Sequence 
(5')XXGGATGACCCAGCTAAGGGGGCAGCCAGTTTCACTGCCCAGGTCATCATCATGAACCATCCTGGCCAGATTGGAAATGGATATGC
ACCAGTGCTTGACTGCCACACTTCCCACATTGCTGTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGTTCAGGTAAGGAACTTGA
GAAGGAGCCTAAGTTCTTGAAGAATGGTGATGCTGGTATGGTTAAGATGATTCCCACCAAgCCCAGAAGAAGGGAAAGTAGAgTGCATTT
GATGAGCACGGATGA\(3')AATAGTTTTGTTTATTTGCATCAGTTTTTTTCATTTTTGTTTTGGACAGCATTTTGCCAGTTTTGGATAT
GGCTACAGAAGGTATTGTCATGGTTCTCTAGCCTCTTTTTGAGGATAGTGGAGTAATTGAGCAATTATGTCGGGACCAAATTACTTGATG
GGCAATGACATATAGCTCTGTTGGTTGTTCCTTTACCTGGGTTAAATCACTTTACACACAGTCTTGGTCACTGCTCAACTTATTTAAGTT
TATGAAATTTTGAGTATATTTCCTTCTAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan