ESTScan Details for Unigene SGN-U212838

Score 
1139
Direction 
Forward
Predicted Peptide Sequence 
GFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHH
EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKE
LEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTGAKVTKAAQKKGKXNCAVDAGVSNAFIYI
ECAI
Predicted Coding Sequence 
XXTGGTTTTGAAGGAGACAACATGATTGAGAGGTCTACCAACCTCGACTGGTACAAGGGACCAACCCTCCTTGAGGCTCTTGACCAGATT
AATGAGCCCAAGAGGCCATCAGACAAGCCCCTCCGTCTTCCACTTCAGGACGTTTACAAGATTGGTGGAATTGGAACTGTCCCCGTTGGT
CGTGTTGAAACTGGTGTGATCAAGCCTGGTATGGTTGTGACCTTTGGCCCTACTGGTTTGACAACTGAAGTCAAGTCTGTAGAGATGCAC
CACGAAGCTCTCCAGGAGGCACTCCCTGGTGACAATGTTGGGTTCAATGTTAAGAATGTTGCTGTTAAGGATCTTAAGCGTGGTTATGTT
GCCTCAAACTCCAAGGATGACCCAGCCAAGGGGGCAGCCAGCTTCACTGCCCAGGTCATCATCATGAACCATCCTGGCCAGATTGGAAAC
GGATATGCCCCTGTGCTCGACTGTCACACTTCACACATTGCTGTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGTTCAGGTAAG
GAACTTGAGAAGGAGCCTAAGTTCTTGAAGAACGGTGATGCTGGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTTGAGACCTTT
GCTGAATACCCTCCATTGGGTCGTTTTGCTGTGAGGGACATGAGGCAGACTGTTGCTGTCGGTGTTGTCAAGAATGTTGACAAGAAGGAC
CCAACTGGTGCCAAGGTGACCAAGGCTGCCCAGAAGAAGGGGAAGXTGAACTGTGCAGTTGATGCTGGTGTTTCGAATGCATTTATTTAC
ATCGAGTGTGCTATCTAG\
Edits in Original Sequence 
(5')XXTGGTTTTGAAGGAGACAACATGATTGAGAGGTCTACCAACCTCGACTGGTACAAGGGACCAACCCTCCTTGAGGCTCTTGACCA
GATTAATGAGCCCAAGAGGCCATCAGACAAGCCCCTCCGTCTTCCACTTCAGGACGTTTACAAGATTGGTGGAATTGGAACTGTCCCCGT
TGGTCGTGTTGAAACTGGTGTGATCAAGCCTGGTATGGTTGTGACCTTTGGCCCTACTGGTTTGACAACTGAAGTCAAGTCTGTAGAGAT
GCACCACGAAGCTCTCCAGGAGGCACTCCCTGGTGACAATGTTGGGTTCAATGTTAAGAATGTTGCTGTTAAGGATCTTAAGCGTGGTTA
TGTTGCCTCAAACTCCAAGGATGACCCAGCCAAGGGGGCAGCCAGCTTCACTGCCCAGGTCATCATCATGAACCATCCTGGCCAGATTGG
AAACGGATATGCCCCTGTGCTCGACTGTCACACTTCACACATTGCTGTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGTTCAGG
TAAGGAACTTGAGAAGGAGCCTAAGTTCTTGAAGAACGGTGATGCTGGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTTGAGAC
CTTTGCTGAATACCCTCCATTGGGTCGTTTTGCTGTGAGGGACATGAGGCAGACTGTTGCTGTCGGTGTTGTCAAGAATGTTGACAAGAA
GGACCCAACTGGTGCCAAGGTGACCAAGGCTGCCCAGAAGAAGGGGAAGXTGAACTGTGCAGTgTGATGCTGGTGTTTCGAATGCtATTT
ATTTACATCGAGTGTGCTATCTAG\(3')ACTCTGTTTTATTTAATTCTGCTTTAGTTTGGTCTTTGAGTTGTGTATTAGGTTGTAGTTC
TCTGACTTGTATCTCAAGTATCCATTCTCAGAACTGGGTACTTGATAGGCGGTGGCGAGCATGATTTTGAGTCTGTTATCATTTGCTTTT
GTTGAGGTGCCTTGGTTTGTTTTCCATGGTGGCTCAGGATTTTTGTTGCTTTAATTTGAGATTTAAGTTTTCTACTCAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan