ESTScan Details for Unigene SGN-U212845

Score 
2040
Direction 
Forward
Predicted Peptide Sequence 
MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVI
DAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK
VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGP
TGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTGAKVTKAAPEEGKVD
AFDEHG
Predicted Coding Sequence 
ATGGGTAAAGAGAAGATTCACATCAGCATCGTGGTCATTGGTCATGTTGACTCTGGAAAGTCGACTACCACTGGTCACTTGATCTACAAG
CTTGGTGGTATTGACAAGCGTGTTATTGAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTATGCCTGGGTGCTT
GACAAACTTAAGGCAGAACGTGAGCGTGGTATCACCATTGATATTGCTTTGTGGAAGTTTGAGACCACTAAGTACTACTGCACTGTTATT
GATGCCCCCGGCCACAGGGATTTCATCAAGAACATGATCACTGGTACCTCTCAGGCTGACTGTGCTGTTCTCATTATTGACTCCACTACT
GGTGGTTTTGAAGCTGGTATCTCCAAAGATGGTCAGACCCGTGAACATGCATTGCTTGCTTTCACCCTTGGTGTCAAGCAAATGATCTGC
TGCTGTAACAAGATGGATGCTACCACCCCCAAGTACTCCAAGGCTAGGTATGATGAAATCGTGAAGGAAGTTTCTTCCTACCTCAAGAAG
GTTGGTTACAACCCTGACAAAATCCCCTTTGTTCCAATCTCTGGTTTTGAAGGAGACAACATGATTGAGAGGTCTACCAACCTCGACTGG
TACAAGGGACCAACCCTCCTTGAGGCTCTTGACCAGATTAATGAGCCCAAGAGGCCATCAGACAAGCCCCTCCGTCTTCCACTTCAGGAC
GTTTACAAGATTGGTGGAATTGGAACTGTCCCCGTTGGTCGTGTTGAAACTGGTGTAATCAAGCCTGGTATGGTTGTGACCTTTGGCCCT
ACTGGTTTGACAACTGAAGTCAAGTCTGTTGAGATGCACCACGAAGCTCTCCAGGAGGCGCTCCCTGGAGACAATGTTGGGTTCAATGTT
AAGAATGTTGCTGTTAAGGATCTTAAGCGTGGTTATGTTGCCTCAAACTCCAAGGATGACCCAGCTAAGGGGGCAGCCAGTTTCACTGCC
CAGGTCATCATCATGAACCATCCTGGCCAGATTGGAAATGGATATGCACCAGTGCTTGACTGCCACACTTCCCACATTGCTGTCAAGTTT
GCTGAGATCTTGACCAAGATTGACAGGCGTTCAGGTAAGGAACTTGAGAAGGAGCCTAAGTTCTTGAAGAATGGTGATGCTGGTATGGTT
AAGATGATTCCCACCAAGCCCATGGTTGTTGAGACCTTTGCCGAATACCCACCATTGGGTCGTTTTGCTGTGAGGGACATGAGGCAAACT
GTTGCTGTGGGTGTTGTCAAGAATGTTGACAAGAAGGACCCAACTGGTGCCAAGGTCACCAAGGCTGCXCCAGAAGAAGGGAAAGTAGAT
GCATTTGATGAGCACGGATGA\
Edits in Original Sequence 
CCCCCCCCCTTTTTTTTTTTTTTTTTTTTTTTTTTGTTCCATGCTATCAAAAAATCAAAGATTTTTTCTGAAATGAAAAATACAGTAACA
TTAGTTGACACTTCCTGGTAGCAGATAATCATGCACTCTCCAATATAAAATTACTCCTACAGAGACTAGAAATCGCACAAGGAAAACACA
ACATTTTTGCAACCCTGCATACTAGCATATGGTTTTTCTCCTCAGCTGTGCCGCATATCGCCTAATTTTTCTTCTCTAAGTTTCTTAGTG
TCTCAAG
(5')ATGGGTAAAGAGAAGATTCACATCAGCATCGTGGTCATTGGTCATGTTGACTCTGGAAAGTCGACTACCACTGGTCACT
TGATCTACAAGCTTGGTGGTATTGACAAGCGTGTTATTGAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTATG
CCTGGGTGCTTGACAAACTTAAGGCAGAACGTGAGCGTGGTATCACCATTGATATTGCTTTGTGGAAGTTTGAGACCACTAAGTACTACT
GCACTGTTATTGATGCCCCCGGCCACAGGGATTTCATCAAGAACATGATCACTGGTACCTCTCAGGCTGACTGTGCTGTTCTCATTATTG
ACTCCACTACTGGTGGTTTTGAAGCTGGTATCTCCAAAGATGGTCAGACCCGTGAACATGCATTGCTTGCTTTCACCCTTGGTGTCAAGC
AAATGATCTGCTGCTGTAACAAGATGGATGCTACCACCCCCAAGTACTCCAAGGCTAGGTATGATGAAATCGTGAAGGAAGTTTCTTCCT
ACCTCAAGAAGGTTGGTTACAACCCTGACAAAATCCCCTTTGTTCCAATCTCTGGTTTTGAAGGAGACAACATGATTGAGAGGTCTACCA
ACCTCGACTGGTACAAGGGACCAACCCTCCTTGAGGCTCTTGACCAGATTAATGAGCCCAAGAGGCCATCAGACAAGCCCCTCCGTCTTC
CACTTCAGGACGTTTACAAGATTGGTGGAATTGGAACTGTCCCCGTTGGTCGTGTTGAAACTGGTGTAATCAAGCCTGGTATGGTTGTGA
CCTTTGGCCCTACTGGTTTGACAACTGAAGTCAAGTCTGTTGAGATGCACCACGAAGCTCTCCAGGAGGCGCTCCCTGGAGACAATGTTG
GGTTCAATGTTAAGAATGTTGCTGTTAAGGATCTTAAGCGTGGTTATGTTGCCTCAAACTCCAAGGATGACCCAGCTAAGGGGGCAGCCA
GTTTCACTGCCCAGGTCATCATCATGAACCATCCTGGCCAGATTGGAAATGGATATGCACCAGTGCTTGACTGCCACACTTCCCACATTG
CTGTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGTTCAGGTAAGGAACTTGAGAAGGAGCCTAAGTTCTTGAAGAATGGTGATG
CTGGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTTGAGACCTTTGCCGAATACCCACCATTGGGTCGTTTTGCTGTGAGGGACA
TGAGGCAAACTGTTGCTGTGGGTGTTGTCAAGAATGTTGACAAGAAGGACCCAACTGGTGCCAAGGTCACCAAGGCTGCXCCAGAAGAAG
GGAAAGTAGAgTGCATTTGATGAGCACGGATGA\(3')AATAGTTTTGTTTATTTGCATCAGTTTTTTTCATTTTTGTTTTGGACAGCAT
TTTGCCAGTTTTGGATATGGCTACAGAAGGTATTGTCATGGTTCTCTAGCCTCTTTTTGAGGATAGTGGAGTAATTGAGCAATTATGTCG
GGACCAAATTACTTGATGGGCAATGACATATAGCTCTGTTGGTTGTTCCTTTACCTGGGTTAAATCACTTTACACACAGTCTTGGTCACT
GCTCAACTTATTTAAGTTTATGAAATTTTGAGTATATTTCCTTCTAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan