Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U212916

Score 
179
Direction 
Forward
Predicted Peptide Sequence 
EYPGQVLRYEDNFDSTSNLIVAVTPTDKKSITDYGSPEEFLSKVDYLLGKQAYFGKTDSEEVIITTSYNSYDMSKDXLTLNPLLYNLATA
SFEYEQMSLQFSQYISYPESSLQGAESLRKIVTSNHTPPTQVSKMHFNLPTVFPINQNKPYNNNGMSEVQNHVSVPRKLESAIXVLIVCV
APPCIXPNLTEXNAWGKMKWGFFVQGGFESGAVATANLLEASSATVGGKX
Predicted Coding Sequence 
GAGTACCCTGGTCAGGTTCTCAGATATGAAGACAACTTTGATTCCACAAGTAATCTTATTGTTGCAGTTACTCCAACTGACAAGAAGTCC
ATCACCGACTACGGCTCCCCTGAAGAGTTCCTCTCTAAAGTGGACTATCTGCTAGGAAAGCAAGCTTACTTTGGTAAAACTGATTCAGAG
GAAGTAATCATAACTACTAGCTACAATTCTTATGACATGAGTAAAGATXCACTAACATTAAACCCACTTCTATATAACTTGGCAACTGCT
AGCTTCGAGTATGAACAAATGAGTCTACAATTCAGTCAGTATATAAGCTACCCTGAAAGTAGTCTTCAAGGGGCAGAATCACTCCGTAAG
ATTGTAACAAGTAATCATACACCACCCACGCAAGTAAGTAAAATGCATTTCAATTTACCAACTGTTTTTCCTATAAATCAAAACAAACCA
TACAACAACAATGGAATGAGTGAAGTGCAAAACCATGTGTCCGTCCCAAGGAAGTTGGAGTCGGCTATATAGGTCCTCATTGTCTGTGTT
GCTCCGCCCTGCATTGXTCCTAATTTAACTGAAXCTAATGCATGGGGAAAAATGAAATGGGGATTCTTTGTGCAGGGAGGATTTGAATCT
GGAGCAGTGGCAACTGCTAACCTGTTGGAGGCATCAAGCGCAACAGTGGGAGGAAAAGAX\
Edits in Original Sequence 
(5')GAGTACCCTGGTCAGGTTCTCAGATATGAAGACAACTTTGATTCCACAAGTAATCTTATTGTTGCAGTTACTCCAACTGACAAGAA
GTCCATCACCGACTACGGCTCCCCTGAAGAGTTCCTCTCTAAAGTGGACTATCTGCTAGGAAAGCAAGCTTACTTTGGTAAAACTGATTC
AGAGGtAAGTAATCATAACTACTAGCTACAATTCTTATGACATGAGTAAAGATXCACTAACATTAAACCCACTTCTATATAACTTGaGCA
ACTGCTAGCTTCGAGTATGAACAAATGAGTCTACAATTCAGTCAGTATATAAGCTACCCTGtAAAGTAGTCTTCAAGGGGCAGAATCACT
CCGTAAGATTGTAACAAGTAATCATACACCACCCACGCAAGTAAGTAAAATGCATTTCAATTTACCAACTGtTTTTTCCTATAAATCAAA
ACAAACCATACAACAACAcATGGAATGAGTGAAGTGCAAAACCATGTGTCCGTCCCAAGGAAGTTGGAGTCGGCTATATAGGTCCTCATT
GTCTGTGTTGCTCCGCCCTGCATTGXTCCTAATTTAACTGAAXCTAATGCATGGGGAAAAATGAAATGGGGATTCgTTTGTGCAGGGAGG
ATTTGAATCTGGAGCAGTGGCAACTGCTAACCTGTTGGAGGCATCAAGCGCAACAGTGGGAGGAAAAGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan