ESTScan Details for Unigene SGN-U212944

Score 
1333
Direction 
Forward
Predicted Peptide Sequence 
MALHLSIGCLCCLSPMRGQKQKIRGVAAESSVKLNSEEEDKVKLGGSDLKVTKLGIGAWSWGDTSYWNNFEWDDKKLKAAKTAFDASIDS
GITFIDTAEVYGSRFSFGAINSETLLGRFIKERKEKDPEVEVAVATKFAALPWRLGRQSVLAALKDSLARMELSSVDLYQLHWPGIWGNE
GYIDGLGDAVEQGLVKAVGVSNYSEKRLRDAYEQLKRRGIPLASNQVNYSLIYRLPEQNGVKAACDELGVTLIAYSPIAQGALTGKYTPE
NPPTGPRGQIYTPEVLTKLQPLINRIKEIGDSYNKTSTQVVLNWLIAQENVVPIPGAKNAEQAKEFGGALGWRLTQQEIDQLRSLASELK
PVTGFPVEKL
Predicted Coding Sequence 
ATGGCTTTGCATTTGAGCATTGGGTGTTTGTGTTGTTTAAGCCCAATGAGGGGTCAGAAACAGAAAATCAGAGGTGTAGCAGCTGAGAGT
AGTGTTAAACTTAACTCAGAAGAAGAAGATAAGGTGAAGCTTGGTGGCTCTGATTTGAAGGTAACTAAGCTTGGAATTGGGGCTTGGTCT
TGGGGTGACACAAGCTATTGGAACAACTTCGAATGGGATGATAAGAAACTTAAGGCTGCAAAGACTGCTTTTGATGCTAGCATTGATTCT
GGAATCACATTCATCGATACTGCTGAGGTTTATGGTTCAAGGTTTTCATTCGGTGCGATAAATTCTGAAACACTACTAGGAAGATTCATC
AAGGAAAGAAAAGAAAAAGATCCAGAGGTGGAGGTTGCTGTTGCAACTAAATTTGCTGCATTACCATGGAGGCTTGGTCGTCAAAGTGTC
CTAGCGGCCCTAAAAGATTCTCTTGCACGTATGGAACTTTCTTCAGTTGATCTTTATCAACTTCACTGGCCAGGAATATGGGGAAATGAA
GGTTATATTGACGGTTTAGGAGATGCAGTGGAGCAGGGCCTTGTAAAAGCTGTGGGAGTATCTAACTATAGTGAAAAGCGTCTTCGCGAT
GCATATGAGCAGCTGAAGAGGAGAGGTATTCCACTAGCTTCAAATCAAGTCAATTATAGTCTGATATACAGGTTGCCAGAGCAAAATGGT
GTCAAGGCCGCCTGTGATGAATTGGGAGTCACATTGATTGCATATTCACCCATTGCTCAAGGAGCTTTGACTGGAAAATATACTCCAGAA
AATCCTCCCACTGGCCCTCGCGGACAGATCTATACTCCTGAAGTTCTTACCAAATTGCAGCCACTCATAAATAGAATAAAGGAGATTGGA
GATAGCTACAATAAGACTTCAACTCAGGTGGTCCTGAATTGGTTGATTGCACAGGAGAATGTTGTTCCCATCCCAGGAGCCAAAAATGCT
GAGCAGGCTAAAGAATTTGGTGGTGCGTTGGGTTGGAGACTAACCCAACAAGAAATAGACCAACTTCGTTCATTGGCATCAGAATTAAAA
CCTGTTACTGGTTTCCCTGTCGAAAAGTTGTAA\
Edits in Original Sequence 
TAATCTGTGTCAAAATTTCGTAATTGTAAGCGAGAGTAGTTACGTGAAGTGACATTAACCGAACACTTGCCTCATCCATGATATACAAAT
AGTTGAAATTTGATTCACAGTTTTGTTAATACGAA
(5')ATGGCTTTGCATTTGAGCATTGGGTGTTTGTGTTGTTTAAGCCCAATGAGG
GGTCAGAAACAGAAAATCAGAGGTGTAGCAGCTGAGAGTAGTGTTAAACTTAACTCAGAAGAAGAAGATAAGGTGAAGCTTGGTGGCTCT
GATTTGAAGGTAACTAAGCTTGGAATTGGGGCTTGGTCTTGGGGTGACACAAGCTATTGGAACAACTTCGAATGGGATGATAAGAAACTT
AAGGCTGCAAAGACTGCTTTTGATGCTAGCATTGATTCTGGAATCACATTCATCGATACTGCTGAGGTTTATGGTTCAAGGTTTTCATTC
GGTGCGATAAATTCTGAAACACTACTAGGAAGATTCATCAAGGAAAGAAAAGAAAAAGATCCAGAGGTGGAGGTTGCTGTTGCAACTAAA
TTTGCTGCATTACCATGGAGGCTTGGTCGTCAAAGTGTCCTAGCGGCCCTAAAAGATTCTCTTGCACGTATGGAACTTTCTTCAGTTGAT
CTTTATCAACTTCACTGGCCAGGAATATGGGGAAATGAAGGTTATATTGACGGTTTAGGAGATGCAGTGGAGCAGGGCCTTGTAAAAGCT
GTGGGAGTATCTAACTATAGTGAAAAGCGTCTTCGCGATGCATATGAGCAGCTGAAGAGGAGAGGTATTCCACTAGCTTCAAATCAAGTC
AATTATAGTCTGATATACAGGTTGCCAGAGCAAAATGGTGTCAAGGCCGCCTGTGATGAATTGGGAGTCACATTGATTGCATATTCACCC
ATTGCTCAAGGAGCTTTGACTGGAAAATATACTCCAGAAAATCCTCCCACTGGCCCTCGCGGACAGATCTATACTCCTGAAGTTCTTACC
AAATTGCAGCCACTCATAAATAGAATAAAGGAGATTGGAGATAGCTACAATAAGACTTCAACTCAGGTGGTCCTGAATTGGTTGATTGCA
CAGGAGAATGTTGTTCCCATCCCAGGAGCCAAAAATGCTGAGCAGGCTAAAGAATTTGGTGGTGCGTTGGGTTGGAGACTAACCCAACAA
GAAATAGACCAACTTCGTTCATTGGCATCAGAATTAAAACCTGTTACTGGTTTCCCTGTCGAAAAGTTGTAA\(3')ACATCATTTTACA
TGTACATTAACAAAGTCTTCGAAATGTAACTAGTACTAATAAAGCTGCTGCTGCTGCAACATCGTAATCCGTGCTCATAAGTGGAGTTTC
GAGAAGGTGATATATATATACTAGTTTTCGAAACGTGCTTGCACGTTTGTCCCATACAATTATTATAAAGTTGAATTATTATATAATATT
GAAATTAGAAATATTAAAAAAAAAAAAAAAAAAATTTTATTCATTAAATAAAATTCATAATAATCGAATAGTAAAAAAAAAAAAAAAAAA
AA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan