Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U212965

Score 
740
Direction 
Forward
Predicted Peptide Sequence 
KPIENLALTPTSLPPLRRSLNLQRRFFPFYFXAMSKLQSDALREAITVIKNDSSEKKRKFTETIELQIGLKNYDPQKDKRFSGSVKLPHI
PRPKMKICMLGDAQHVGEAEKIGLEYMDVEGLKKLNKNKKLVKKLAKKYHAFLASEAVIKQIPRLLGPGLNKAGKFPTLVSHQESLESKV
NETKATIKFQLKKVLCMGVAVGNXGYGGETNLPERADECQLSRVLAKEELAKCEMLVLEEYHGKDSTHLLRTLYYNLCSFRRFDLYAL
Predicted Coding Sequence 
XACAAGCCCATTGAGAACTTAGCTTTAACCCCAACTTCTTTGCCACCACTCCGCCGCTCACTCAATTTGCAGAGACGATTCTTCCCATTC
TACTTTGXAGCCATGAGTAAGCTTCAGAGTGATGCCTTAAGAGAAGCCATCACCGTGATTAAGAATGATTCAAGTGAGAAGAAAAGGAAG
TTCACCGAAACCATTGAGCTTCAGATTGGTTTGAAAAACTATGATCCTCAAAAGGACAAGCGTTTCAGTGGTTCAGTTAAGTTGCCACAC
ATTCCTCGCCCCAAGATGAAGATTTGCATGCTTGGAGATGCTCAGCACGTGGGAGAGGCAGAAAAGATTGGTTTGGAGTACATGGATGTG
GAAGGTCTGAAGAAGCTTAATAAAAACAAGAAGTTGGTTAAGAAGCTCGCAAAGAAGTACCATGCTTTCTTGGCATCAGAAGCTGTTATC
AAGCAGATCCCCCGTCTCTTGGGGCCTGGTTTGAACAAGGCAGGTAAGTTTCCTACCCTTGTTTCCCACCAGGAATCACTCGAGTCTAAG
GTAAACGAGACCAAGGCGACTATCAAATTCCAGTTGAAGAAGGTTCTTTGCATGGGAGTTGCCGTAGGTAATXATGGATATGGAGGAGAA
ACAAATCTTCCAGAACGTGCAGATGAGTGTCAACTTTCTCGTGTCCTTGCTAAAGAAGAATTGGCAAAATGTGAGATGCTTGTACTTGAA
GAGTACCATGGGAAAGACTCAACGCATCTTCTAAGGACATTGTATTACAATCTTTGCAGTTTCAGGCGTTTTGACTTGTACGCGTTATAG
\
Edits in Original Sequence 
(5')XACAAGCCCATTGAGAACTTAGCTTTAACCCtCAACTTCTTTGCCACCACTCCGCCGCTCACTCAATTTGCAGAGACGATTCTTCC
CATTCTACTTTGXAGCCATGAGTAAGCTTCAGAGTGATGCCTTAAGAGAAGCCATCACCGTGATTAAGAATGATTCAAGTGAGAAGAAAA
GGAAGTTCACCGAAACCATTGAGCTTCAGATTGGTTTGAAAAACTATGATCCTCAAAAGGACAAGCGTTTCAGTGGTTCAGTTAAGTTGC
CACACATTCCTCGCCCCAAGATGAAGATTTGCATGCTTGGAGATGCTCAGCACGTGGGAGAGGCAGAAAAGATTGGTTTGGAGTACATGG
ATGTGGAAGGTCTGAAGAAGCTTAATAAAAACAAGAAGTTGGTTAAGAAGCTCGCAAAGAAGTACCATGCTTTCTTGGCATCAGAAGCTG
TTATCAAGCAGATCCCCCGTCTCTTGGGGCCTGGTTTGAACAAGGCAGGTAAGTTTCCTACCCTTGTTTCCCACCAGGAATCACTCGAGT
CTAAGGTAAACGAGACCAAGGCGACTATCAAATTCCAGTTGAAGAAGGTTCTTTGCATGGGAGTTGCCGTAGGTAATXATGGATATGGAG
GAGAAACAAATCTTCCAGAACGTGCAGATGAGTGTCAACTTTCTCGTGTCCTTGCTAAAGAAGAATTGGCAAAATGTGAGATGCTTGTAC
TTGAAGAGTACCATGGGAAAGACTCAACGCATCTTCTAAGGACATTGTATTACAATCTTTGCAGTTTCAGGCGTTTTGACTTGTACGCGT
TATAG\(3')ATACTATTGCATTTTTTGTTTAGTTGTGCTCCTTGGATACTGAGTTGAAAACTTTATATCAGTTTTGTTATGATTTTACT
TTTTCTTTTCTCCTTTCTGTTGATTTTCTTGAATATTGTCAACTTTCATATCTAAAGGAAAACTCAAATTTTGTGGTTAAAAAAAAAAAA
AAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan