Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U213177

Score 
353
Direction 
Reverse
Predicted Peptide Sequence 
MLHEQVGFCSLVSSLEFPGWWSDFLEHQGELDFGVMELLGALPLAQFSWNSGRLNDLDAVMADPXDVKPSLCTSVPQLHSMWYHGTPCTC
CGTQCDSDNATKCRNFDLSRILLKDLINSKHLPVALLNLLQLPQKIPELGFRTDLIGSPKLHAVDLWVFIXSLMGELYPPPGTDEI
Predicted Coding Sequence 
ATGTTACATGAACAAGTTGGGTTTTGTAGCCTTGTAAGTAGTCTTGAGTTTCCTGGATGGTGGTCTGACTTTCTTGAACACCAAGGGGAA
CTTGATTTTGGAGTCATGGAACTGCTTGGTGCTCTCCCTCTTGCACAGTTTAGCTGGAATAGTGGCCGTCTTAATGATCTGGATGCAGTG
ATGGCGGACCCTGXTGACGTGAAGCCATCTCTGTGTACATCTGTTCCACAGCTCCATTCAATGTGGTATCACGGTACTCCTTGTACATGT
TGTGGTACCCAGTGCGACTCTGATAACGCAACCAAATGCCGTAATTTTGATCTTAGTAGGATACTTCTCAAAGATCTCATTAATAGCAAG
CATCTGCCCGTTGCTCTTCTTAACCTTCTTCAGCTTCCTCAAAAAATACCAGAACTTGGATTTCGCACGGACCTCATTGGTAGCCCAAAG
CTTCATGCGGTAGATCTTTGGGTGTTCATCGXGTCTCTGATGGGAGAGCTCTACCCACCACCTGGTACTGATGAAATTTGA\
Edits in Original Sequence 
TTTTTTTTTTTTTTTTATCATAGTAGTAGCAATAGCAGCATTCACAAAACAATAACAAAATTCCAAAAAATTAACAAACCAACCATGACA
GAACACATAACCTGGAACTGGAACTGTTGAAGCAAACAACTTAAGAACTCATTTTTTTGTAACTTTTAACTGTCGGATACCTAGAGTTAT
AAGGAAAAAAGGACAAATGTTTCCATTAATGCCAAACTGGCAAACTAGTGCAACAAAATTAGCATGAATTCTAAGTTGCTTCTCAATAAA
CTTATGACCGAAC
(5')ATGTTACATGAACAAGTTGGGTTTTGTAGCCTTGTAAGTAGTCTTGAGTTTCCTGGATGGTGGTCTGACTTTC
TTGAACACCAAGGGGAACTTGATTTTGGAGTCATGGAACTGCTTGGTGCTCTCCCTCTTGCACAGTTTAGCTGGAATAGTGGCCGTCTTA
ATGATCTGGATGCAGTGATGGCGGACCCTGXTGACGTGAAGCCATCTCTGTGTACATCTGTTCCACAGCTCCATTCAATGTGGTATCACG
GTACTCCTTGTACATGTTGTGGTACCCAGTGCGACTCTGATAACGCAACCAAATGCCGTAATTcTTGATCTTAGTAGGATACTTCTCAAA
GATCTCATTAATAGCAAGCATCTGCCCGTTGCTCTTCTTAACCTTCTTCAGCTTCCTCAAAAAATACCAGAACTTGGATTTCGCACGGAC
CTCATTGGTAGCCCAAAGCTTCATGCGGTAGATCTTTGGGTGTTCATCGXGTCTCTGATGGGAGAGCTCTACCCACCACCTGGTACTGAT
GAAATTTGA\(3')AGGTCACCATTTTCAGTGCCGTTCTCTCTCTCTCTCCCTCTCCCTCTCAAGCTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan