ESTScan Details for Unigene SGN-U213222

Score 
343
Direction 
Forward
Predicted Peptide Sequence 
SLPGDFGFDPLGLASDPESLRWNQQAELDTADGQCWELQEFSFQNYSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAH
LADPGHATIFAAFIPSEKQKQNTFCCNDV
Predicted Coding Sequence 
XGCAGCCTTCCCGGAGACTTCGGTTTCGATCCTCTTGGTCTAGCATCTGATCCAGAGAGCTTGAGATGGAACCAACAGGCAGAACTTGAC
ACTGCAGATGGGCAATGTTGGGAGCTGCAGGAATTTTCATTCCAGAATTACTCACCTGCAAAGATAAAGGAGTTGAGGACAAAGGAGATT
AAGAACGGTAGACTTGCTATGTTAGCCGTTATGGGTGCATGGTTCCAACACATTTACACTGGAACAGGCCCTATTGATAACCTATTTGCT
CACCTAGCTGATCCTGGTCATGCCACTATTTTTGCTGCATTCATCCCAAGTGAGAAGCAGAAGCAGAACACCTTTTGTTGTAATGATGTG
TAA\
Edits in Original Sequence 
(5')XGCAGCCTTCCCGGAGACTTCGGTTTCGATCCTCTTGGTCTAGCATCTGATCCAGAGAGCTTGAGATGGAACCAACAGGCAGAACT
TGtACACTGCAGATGGGCAATGTTGGGAGCTGCAGGAATTTTCATTCCAGAATTACTCACCTGCAAAGATAAAGGAGTTGAGGACAAAGG
AGATTAAGAACGGTAGACTTGCTATGTTAGCCGTTATGGGTGCATGGTTCCAACACATTTACACTGGAACAGGCCCTATTGATAACCTAT
TTGCTCACCTAGCTGATCCTGGTCATGCCACTATTTTTGCTGCATTCAgTCCCAAGTGAGAAGCAGAAGCAGAACACCTTTTGTTGTAAT
GATGTGTAA\(3')AAGTAACATTTGAAGTAGATTTGTGCAAAGAAAAACTTTAATGTTTCTTTTGCCACTCAATGTAGTATACCTACAT
TTGGTTTGCCCTCCTGTAGAAAAAGACTCAGTGTACAAATACCTTTGAGAATTCGTGTCAGATCAAAAAAATCTATTTATATAAAAAAAA
AAAAAATAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan