ESTScan Details for Unigene SGN-U213231

Score 
1410
Direction 
Forward
Predicted Peptide Sequence 
QIRRSYDFKDGVDAAKKRDAQKKAAAAARRGGKGAAAPKSAATASKSAVESNGVDNLTNGVGDLQISDRTCTGVLCSHPLSRDIRIESLS
VTFHGHDLIVDSELELNYGRRYGLLGLNGCGKSTLLTAIGLRELPIPDHMDIFHLSREIEASDMTSLEAVINCDEERLQLEKEAEALAGQ
DDGGGEQLERIYERLEAMDAATAEKRAAEILFGLGFDKKMQAKKTRDFSGGWRMRIALARALFMNPTILLLDEPTNHLDLEACVWLEESL
KNFERILVVISHSQDFLNGVCTNIIHMQNKKLKLYTGNYDQYVQTRSELEENQMKQYKWEQEQISAMKEYIARFGHGSAKLARQAQSKEK
TLAKMERGGLTEKVGRDSVLVFRFTDVGKLPPPVLQFSEVAFGYTPDNLIYKNLDFGVDLDSRIALVGPNGAGKSTLLKLMIGDLFPTDG
MVKRHNHLKIAQYHQHLAEKLDMEVSALLFMMREYPGNEEEKMRAAIGRFGLTGKAQVMAMKNLSDGQRSRVIFAWLAFRQPHMLLLDEP
TNHLDIETIDSLAEALNAWDGGMVLVSHDFRLINQVAHEIWVCENQAVTRWEGGIMDFKKHLKKRAGLGDXKLRSMCSILESVMVSLFPL
GGSAPRRNGEKHQQGPHHGS
Predicted Coding Sequence 
CAAATCCGTAGATCTTACGATTTCAAAGATGGTGTGGATGCGGCGAAGAAGAGAGATGCGCAGAAGAAGGCGGCGGCAGCTGCTAGGAGA
GGAGGTAAAGGTGCGGCAGCGCCTAAATCGGCTGCAACCGCGTCTAAATCGGCGGTGGAAAGTAACGGGGTTGATAATTTGACGAATGGA
GTAGGGGATCTACAGATATCTGATCGGACTTGTACGGGTGTTTTGTGTTCACATCCGCTATCGAGGGATATTCGGATAGAGTCATTATCA
GTCACTTTCCACGGACATGATCTCATCGTTGATTCTGAACTGGAGCTCAACTATGGCAGACGTTATGGTTTGTTGGGATTGAATGGCTGC
GGGAAGTCTACTCTTCTTACTGCTATAGGGTTGAGGGAACTTCCCATCCCAGACCACATGGATATTTTTCATCTTTCTCGGGAGATTGAA
GCCTCTGACATGACCTCTCTCGAGGCTGTCATTAATTGTGATGAAGAGAGGTTGCAATTGGAGAAAGAAGCTGAAGCTTTGGCTGGACAG
GACGATGGTGGTGGAGAGCAACTTGAACGGATCTATGAGCGTTTAGAAGCTATGGATGCTGCCACTGCTGAGAAACGTGCTGCTGAAATC
TTGTTTGGGCTTGGATTTGATAAGAAAATGCAAGCAAAGAAAACACGTGATTTTTCCGGTGGCTGGAGGATGAGGATTGCTCTTGCCCGT
GCCCTCTTTATGAATCCAACAATTTTGTTGCTTGATGAGCCAACAAACCATCTTGACCTAGAGGCCTGTGTGTGGTTAGAAGAATCCTTG
AAGAACTTTGAGCGCATTCTGGTTGTCATTTCACACTCACAGGATTTTCTCAATGGTGTGTGTACCAATATCATCCACATGCAAAACAAG
AAGTTAAAACTCTATACAGGTAACTACGACCAATATGTGCAAACCCGTTCAGAGCTGGAAGAAAACCAGATGAAACAGTACAAGTGGGAG
CAGGAGCAGATTTCTGCAATGAAGGAATACATTGCTCGCTTTGGGCACGGTTCAGCTAAACTAGCCCGTCAAGCACAGAGTAAAGAGAAG
ACATTGGCTAAGATGGAGCGTGGTGGGCTTACTGAGAAGGTGGGGAGGGACAGTGTCCTGGTTTTCCGGTTTACTGATGTCGGCAAACTT
CCTCCTCCAGTTCTACAGTTTTCAGAAGTTGCTTTTGGCTACACACCTGATAACCTCATCTACAAGAACCTTGATTTTGGTGTAGATCTC
GACTCCAGGATAGCACTTGTGGGGCCTAATGGAGCTGGAAAGAGCACACTGCTTAAGCTGATGATAGGGGATTTATTTCCCACTGATGGC
ATGGTTAAGCGGCATAATCACCTAAAAATTGCGCAGTACCACCAGCACTTGGCTGAGAAGCTAGACATGGAGGTGTCAGCTCTTTTGTTT
ATGATGAGAGAGTACCCTGGGAACGAGGAGGAGAAGATGAGGGCAGCAATTGGGAGGTTTGGACTCACAGGTAAAGCTCAAGTAATGGCA
ATGAAGAACTTGTCAGATGGTCAACGTAGTCGAGTGATTTTTGCATGGTTGGCTTTTAGGCAACCCCACATGCTGCTGTTGGATGAGCCA
ACCAACCATCTTGATATTGAAACCATTGACTCACTTGCAGAGGCCTTGAACGCATGGGATGGTGGGATGGTTCTAGTGAGTCACGACTTT
AGGCTCATAAACCAGGTGGCCCATGAGATATGGGTATGTGAAAATCAGGCTGTGACACGATGGGAGGGTGGCATCATGGATTTCAAGAAA
CACTTGAAGAAAAGGGCTGGATTGGGTGATXTAAAATTAAGATCAATGTGTTCTATATTAGAAAGTGTGATGGTATCACTATTTCCTCTT
GGTGGTTCAGCGCCAAGGCGTAATGGTGAAAAACATCAGCAGGGGCCCCATCACGGTAGCTGA\
Edits in Original Sequence 
ATTCGGCACGAGGGTTCCTCTCTTCTATAACAAATTTCTC(5')CAAATCCGTAGATCTTACGATTTCAAAGATGGTGTcGGATGCGGCG
AAGAAGAGAGATGCGCAGAAGAAGGCGGCGGCAGCTGCTAGGAGAGGAGGTAAAGGTGCGGCAGCGCCTAAATCGGCTGCAACCGCGTCT
AAATCGGCGGTGGAAAGTAACGGGGTTGATAATTTGACGAATGGAGTAGGGGATCTACAGATATCTGATCGGACTTGTACGGGTGTTTTG
TGTTCACATCCGCTATCGAGGGATATTCGGATAGAGTCATTATCAGTCACTTTCCACGGACATGATCTCATCGTTGATTCTGAACTGGAG
CTCAACTATGGCAGACGTTATGGTTTGTTGGGATTGAATGGCTGCGGGAAGTCTACTCTTCTTACTGCTATAGGGTTGAGGGAACTTCCC
ATCCCAGACCACATGGATATTTTTCATCTTTCTCGGGAGATTGAAGCCTCTGACATGACCTCTCTCGAGGCTGTCATTAATTGTGATGAA
GAGAGGTTGCAATTGGAGAAAGAAGCTGAAGCTTTGGCTGGACAGGACGATGGTGGTGGAGAGCAACTTGAACGGATCTATGAGCGTTTA
GAAGCTATGGATGCTGCCACTGCTGAGAAACGTGCTGCTGAAATCTTGTTTGGGCTTGGATTTGATAAGAAAATGCAAGCAAAGAAAACA
CGTGATTTTTCCGGTGGCTGGAGGATGAGGATTGCTCTTGCCCGTGCCCTCTTTATGAATCCAACAATTTTGTTGCTTGATGAGCCAACA
AACCATCTTGACCTAGAGGCCTGTGTGTGGTTAGAAGAATCCTTGAAGAACTTTGAGCGCATTCTGGTTGTCATTTCACACTCACAGGAT
TTTCTCAATGGTGTGTGTACCAATATCATCCACATGCAAAACAAGAAGTTAAAACTCTATACAGGTAACTACGACCAATATGTGCAAACC
CGTTCAGAGCTGGAAGAAAACCAGATGAAACAGTACAAGTGGGAGCAGGAGCAGATTTCTGCAATGAAGGAATACATTGCTCGCTTTGGG
CACGGTTCAGCTAAACTAGCCCGTCAAGCACAGAGTAAAGAGAAGACATTGGCTAAGATGGAGCGTGGTGGGCTTACTGAGAAGGTGGGG
AGGGACAGTGTCCTGGTTTTCCGGTTTACTGATGTCGGCAAACTTCCTCCTCCAGTTCTACAGTTTTCAGAAGTTGCTTTTGGCTACACA
CCTGATAACCTCATCTACAAGAACCTTGATTTTGGTGTAGATCTCGACTCCAGGATAGCACTTGTGGGGCCTAATGGAGCTGGAAAGAGC
ACACTGCTTAAGCTGATGATAGGGGATTTATTTCCCACTGATGGCATGGTTAAGCGGCATAATCACCTAAAAATTGCGCAGTACCACCAG
CACTTGGCTGAGAAGCTAGACATGGAGGTGTCAGCTCTTTTGTTTATGATGAGAGAGTACCCTGGGAACGAGGAGGAGAAGATGAGGGCA
GCAATTGGGAGGTTTGGACTCACAGGTAAAGCTCAAGTAATGGCAATGAAGAACTTGTCAGATGGTCAACGTAGTCGAGTGATTTTTGCA
TGGTTGGCTTTTAGGCAACCCCACATGCTGCTGTTGGATGAGCCAACCAACCATCTTGATATTGAAACCATTGACTCACTTGCAGAGGCC
TTGAACGCATGGGATGGTGGGATGGTTCTAGTGAGTCACGACTTTAGGCTCATAAACCAGGTGGCCCATGAGATATGGGTATGTGAAAAT
CAGGCTGTGACACGATGGGAGGGTGGCATCATGGATTTCAAGAAACACTTGAAGAAAAGGGCTGGATTGGGTGATXTAAAATTAAGATCA
ATGTGTTCTATATTAGAAAGTGTGATGGTATCACTATTTCCTCTTGGTGGTTCAGCGCCAAGGCGTAATGGTGAAAAACATCAGCAGGGG
CCCCATCACGGTAGCTGA\(3')GGAGAGAAAGTGAAGGCTTCTTGATCACCAGTAAGACCTAAGTAACGTTAGCTAAGACCACGCCTGG
TGCTAGAGAGAGTAAGTGATCGAACTATGGTCACTGACTGTTTGAACTCTGGCTATTGTTCGGGCTTAGTCCACTATTTTTGTCGTCCAT
TTTACTCTAATTACATATTACCGTAGGTTTTGGAGAACATACATTACAGCTTATTCCTTGTGTCATTTCTATTCTATATCATTGCTATAA
TGTACTTCGTATTTTTGAATTCTGATTATGGATTTTTTAAATATATCTGTTTCTATTTTATCTTCAAGGCAAGTAGAATCAGCAGGTTGT
TGAGCCATTATCTTGTTCACAACACTTGGAACGTTATTATTTTGTAGACTTGAAATTGGAGGTAGATAATATGCTTATATACGAGAATCA
ATTTAAACCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan