ESTScan Details for Unigene SGN-U213286

Score 
737
Direction 
Forward
Predicted Peptide Sequence 
MTIQLEGKKVQDQDQFMVPQTNAFGHDFRDYNNAQSERQKGVEKFYKTQHINQTYDFVKKMREDYIKLDKAKMSIWECCELLNDVVDDSD
PDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKILVLPKFGGLPQWAVVGDTFPLGCAFDESNIHHKYFKENQDFNNPIYNTKN
GIYNDFIGLENVMMSWGHDDYMYMVAKENGTTLPSAGLFIXKVSFILSIA
Predicted Coding Sequence 
ATGACTATCCAACTAGAGGGAAAAAAAGTCCAAGACCAAGACCAATTTATGGTGCCTCAAACAAATGCATTTGGACATGATTTTAGGGAC
TACAACAATGCACAAAGTGAAAGGCAAAAAGGGGTAGAAAAATTCTACAAAACACAACATATAAATCAAACCTATGATTTTGTGAAGAAA
ATGAGAGAAGATTACATAAAATTAGACAAAGCAAAAATGAGCATATGGGAATGTTGTGAATTATTAAATGATGTTGTTGATGATAGTGAT
CCTGATTTGGATGAACCACAAATTCAACATTTATTACAAAGTGCTGAGGCAATTAGAAAAGATTATCCTAATGAAGATTGGTTACATTTA
ACAGCCTTAATTCATGATTTAGGTAAAATATTAGTTTTACCTAAGTTTGGTGGTTTACCTCAATGGGCTGTTGTTGGTGACACATTCCCT
TTAGGATGTGCATTTGATGAATCAAATATTCACCATAAATATTTTAAAGAAAATCAAGATTTCAACAACCCAATTTATAACACAAAAAAT
GGAATATATAATGATTTTATTGGACTAGAAAATGTCATGATGTCATGGGGTCATGATGATTATATGTATATGGTTGCTAAAGAAAATGGT
ACAACATTACCATCAGCTGGACTTTTTATTXATAAGGTATCATTCATTTTATCCATTGCATAA\
Edits in Original Sequence 
AAAAACAAATTATTATTTTTATCTTATTTACTATCTTAATTATCCTATCCTAACCTATCCTATCCATCTTTGCTTTGCTTTAATTACTTT
CAATTATTCTCAAATTTGAGATTTGTGTTCTTTGTTGTAGTTCTATTTGTAACAATATCGTGAGTAAAAATTAAGGTCCAGTTGACAATT
TAAGCCAGGCCTTCCAGATCATTCCGCTTTTTTTTTTTAATCATTAAAA
(5')ATGACTATCCAACTAGAGGGAAAAAAAGTCCAAGACC
AAGACCAATTTATGGTGCCTCAAACAAATGCATTTGGACATGATTTTAGGGACTACAACAATGCACAAAGTGAAAGGCAAAAAGGGGTAG
AAAAATTCTACAAAACACAACATATAAATCAAACCTATGATTTTGTGAAGAAAATGAGAGAAGATTACATAAAATTAGACAAAGCAAAAA
TGAGCATATGGGAATGTTGTGAATTATTAAATGATGTTGTTGATGATAGTGATCCTGATTTGGATGAACCACAAATTCAACATTTATTAC
AAAGTGCTGAGGCAATTAGAAAAGATTATCCTAATGAAGATTGGTTACATTTAACAGCCTTAATTCATGATTTAGGTAAAATATTAGTTT
TACCTAAGTTTGGTGGTTTACCTCAATGGGCTGTTGTTGGTGACACATTCCCTTTAGGATGTGCATTTGATGAATCAAATATTCACCATA
AATATTTTAAAGAAAATCAAGATTTCAACAACCCAATTTATAACACAAAAAATGGAATATATAATGATTTTATTGGACTAGAAAATGTCA
TGATGTCATGGGGTCATGATGATTATATGTATATGGTTGCTAAAGAAAATGGTACAACATTACCATCAGCTGGACTTTTTATTXATAAGG
TATCATTCATTTTATCCATTGCATAA\(3')AAATGGAGCTTATAAACATTTAATGAATGATGAAGATGAAGAAAATTTGAAGTGGCTTC
ATGTTTTTAATAAATATGATTTGTATAGTAAAAGCAAAGTTCATGTTAATGTGGAAGAGGTAAAACCTTATTATATGTCTTTAATTGAGA
AATATTTTCCAGCAAAGCTAAGGTGGTGAAAAGGAATATATATATATGAAGTTATGAACAAATTATTTTTTACTATATGGTAAAAATATA
ATTTGTGAGATGTGGATTAAGTTGTATAATATATAGTTTGTACTAATTGAAGTAATTATAATTTATTATCAAGAGTGTTCAATAGTTTCT
TATGGGAATGGAATGGGAAAATTATACTATAAATGCCCATTCTTTCCCTAAGAGATTGAATATGTACATAATTAATAATGATATTAATAA
AATGATATTTAATATTTATTAAAAAAAAAAAAAAAAAAAAAAATCGAGACTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan