ESTScan Details for Unigene SGN-U213371

Score 
1163
Direction 
Forward
Predicted Peptide Sequence 
MLTLGXFYKFYNIYLYKLSTSFQAFSSIMEATAPLVVKPSNVKELAESPDLRCIPYNYVYDSSNSSATNDIDDSDSIPIVDFSLLTSHDS
HQRSTAIHHLTKACQGWGFFMVVNHGIPENLMKSVIDCTHEFFNLPEEEKHKFTGKHVLDPIRYGTSFNTSTENVFFWRDFLKVFVHPHF
HSPTKPQTYRGIMSEYSXETPGSDKKVTGGISESLGLEESYLEKDLELESGLQIFVGNYYPPCPQPELAMGMPPHSDQGLLTLLIHNQVG
GLQVQHQGKWINVKALPNYSLLVNTGDHLEIFSNGKYKSNMHRAVVNNKVTRISVVVAHGPSLDTIVKPASPLMEKENSPSANYIPMKYK
DYLEMQQSSRIYGKSCLEKVKIQRS
Predicted Coding Sequence 
XXGATGCTGACACTTGGGTAATTTTACAAATTCTACAACATTTATCTCTATAAATTATCAACCTCTTTCCAAGCATTTTCATCAATTATG
GAAGCTACAGCTCCACTTGTGGTTAAACCATCCAATGTCAAAGAGCTTGCTGAATCTCCTGATTTGCGTTGCATACCTTACAATTATGTT
TATGACTCTTCCAATTCCTCTGCTACAAATGATATTGATGATTCAGATTCAATCCCCATTGTTGATTTTTCTCTACTCACCTCTCATGAT
TCTCATCAACGTTCTACAGCCATCCACCACCTCACCAAAGCTTGTCAAGGTTGGGGCTTCTTCATGGTAGTGAACCACGGCATACCAGAA
AATCTGATGAAGTCAGTGATTGATTGCACTCATGAATTTTTCAATTTACCAGAGGAAGAAAAACACAAGTTTACTGGGAAGCATGTGTTG
GATCCTATAAGATATGGGACAAGTTTCAATACTAGTACAGAAAATGTCTTCTTTTGGAGAGATTTTCTCAAGGTCTTTGTCCATCCTCAT
TTTCACTCTCCCACCAAACCACAAACCTACAGGGGTATTATGTCGGAGTATAGTGAXGAAACTCCGGGAAGTGACAAGAAAGTTACTGGA
GGCATATCTGAAAGTTTAGGGCTTGAAGAAAGTTACTTGGAGAAAGATTTAGAGTTGGAATCAGGGCTTCAAATCTTCGTTGGAAATTAC
TATCCACCTTGTCCTCAACCTGAACTAGCAATGGGTATGCCACCTCATTCAGATCAAGGCCTTTTAACACTTCTCATTCATAACCAAGTT
GGAGGTCTCCAGGTTCAACATCAAGGCAAATGGATTAACGTCAAGGCCCTTCCTAACTACTCTCTCTTGGTTAATACCGGCGATCATCTC
GAGATATTTAGTAATGGGAAGTACAAGAGCAACATGCATAGAGCAGTGGTGAACAACAAAGTAACAAGGATATCAGTAGTGGTAGCTCAT
GGTCCATCATTAGACACAATTGTAAAGCCAGCTTCTCCATTGATGGAAAAAGAGAACAGCCCATCAGCTAATTATATTCCAATGAAGTAC
AAGGATTACTTGGAGATGCAACAAAGCAGCCGAATTTATGGAAAGTCCTGCTTGGAAAAAGTTAAAATCCAAAGGAGCTGA\
Edits in Original Sequence 
(5')XXGATGCTGACACTTGGGTAATTTTACAAATTCTACAACATTTATCTCTATAAATTATCAACCTCTTTCCAAGCATTTTCATCAAT
TATGGAAGCTACAGCTCCACTTGTGGTTAAACCATCCAATGTCAAAGAGCTTGCTGAATCTCCTGATTTGCGTTGCATACCTTACAATTA
TGTTTATGACTCTTCCAATTCCTCTGCTACAAATGATATTGATGATTCAGATTCAATCCCCATTGTTGATTTTTCTCTACTCACCTCTCA
TGATTCTCATCAACGTTCTACAGCCATCCACCACCTCACCAAAGCTTGTCAAGGTTGGGGCTTCTTCATGGTAGTGAACCACGGCATACC
AGAAAATCTGATGAAGTCAGTGATTGATTGCACTCATGAATTTTTCAATTTACCAGAGGAAGAAAAACACAAGTTTACTGGGAAGCATGT
GTTGGATCCTATAAGATATGGGACAAGTTTCAATACTAGTACAGAAAATGTCTTCTTTTGGAGAGATTTTCTCAAGGTCTTTGTCCATCC
TCATTTTCACTCTCCCACCAAACCACAAACCTACAGGGGTATTATGTCGGAGTATAGTGAXGAAACTCCGGGAAGTGACAAGAAAGTTAC
TaGGAGGCATATCTGAAAGTTTAGGGCTTGAAGAAAGTTACTTGGAGAAAGATTTAGAGTTGGAATCAGGGCTTCAAATCTTCGTTGGAA
ATTACTATCCACCTTGTCCTCAACCTGAACTAGCAATGGGTATGCCACCTCATTCAGATCAAGGCCTTTTAACACTTCTCATTCATAACC
AAGTTGGAGGTCTCCAGGTTCAACATCAAGGCAAATGGATTAACGTCAAGGCCCTTCCTAACTACTCTCTCTTGGTTAATACCGGCGATC
ATCTCGAGATATTTAGTAATGGGAAGTACAAGAGCAACATGCATAGAGCAGTGGTGAACAACAAAGTAACAAGGATATCAGTAGTGGTAG
CTCATGGTCCATCATTAGACACAATTGTAAAGCCAGCTTCTCCATTGATGGAAAAAGAGAACAGCCCATCAGCTAATTATATTCCAATGA
AGTACAAGGATTACTTGGAGATGCAACAAAGCAGCCGAATTTATGGAAAGTCCTGCTTGGAAAAAGTTAAAATCCAAAGGAGCTGA\(3')
GTGTTTCTATGTATATTTTCCTCTTGTTTCCAAGTGTTTGATGATATAAAAGTATTATGGAACTTCAATAATATTTATGAATACTATAG
TTGTACGTGTAATCTTTTAATTAGTGAACGTTTTAGCCGTGTCTGTTTATATGTATATCTTCAAATTAAATGTCATTTTCGGATAAGAGG
GTGATGCTAGTGAAGTAGGGTCATTCCATATATATGTCCAATTGATGACTCTTCCTACTCAAATTGAAGATTCAATTGCTTCTCCAAAAA
AAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan