ESTScan Details for Unigene SGN-U213439

Score 
683
Direction 
Forward
Predicted Peptide Sequence 
MGGSCFLVLLLQIIVTQVVGVGVGVGVGVGVGVGPGGVWFGGGINSPNPGAVPSQSSAYTALQAWKSAITDDPSGILKNWVGPNVCSYKG
IFCSNSQDYMGNPTDPVVTDFQXIIPQTFRDLSSLVELDLSNNHFSGPFPTTVLFIPNLLYLDLRFNSFTGPIPEDLFNRKLDAIFLNNN
QFDGELPQSLGNFPCSVINFAX
Predicted Coding Sequence 
ATGGGGGGAAGTTGCTTTCTGGTTTTGCTTCTTCAAATCATAGTTACTCAAGTTGTTGGTGTTGGTGTTGGTGTTGGCGTTGGCGTTGGT
GTTGGTGTTGGACCTGGAGGTGTTTGGTTTGGTGGAGGGATCAACAGCCCAAACCCAGGAGCTGTCCCAAGTCAAAGTTCAGCATACACT
GCTCTTCAAGCATGGAAATCTGCAATTACTGATGATCCATCGGGGATTTTGAAGAATTGGGTGGGTCCAAATGTGTGTAGTTACAAAGGA
ATTTTCTGCTCAAACTCTCAAGATTACATGGGCAACCCAACAGACCCAGTTGTTACAGATTTTCAGGXTATAATTCCACAAACATTCAGA
GATCTGTCTTCACTCGTTGAATTAGACCTTAGTAACAACCATTTCTCAGGTCCATTCCCTACTACAGTACTATTCATCCCAAATCTTCTT
TATTTAGATCTCAGATTCAACAGTTTCACAGGCCCAATTCCCGAGGATCTGTTCAACAGAAAACTTGATGCTATTTTTCTTAATAATAAC
CAGTTTGATGGTGAACTACCTCAGAGTTTAGGGAATTTCCCCTGCTCAGTCATTAATTTTGCTAXX\
Edits in Original Sequence 
GCACGAGCAGCACCAACTAAACCCACATCGTCTCTCATCAATGCTACAATCACATTTTGTGCAACCTTGCAAAAAAAAGAAAAGACTCTT
GTTTGATCAAAA
(5')ATGGGGGGAAGTTGCTTTCTGGTTTTGCTTCTTCAAATCATAGTTACTCAAGTTGTTGGTGTTGGTGTTGGTGT
TGGCGTTGGCGTTGGTGTTGGTGTTGGACCTGGAGGTGTTTGGTTTGGTGGAGGGATCAACAGCCCAAACCCAGGAGCTGTCCCAAGTCA
AAGTTCAGCATACACTGCTCTTCAAGCATGGAAATCTGCAATTACTGATGATCCATCGGGGATTTTGAAGAATTGGGTGGGTCCAAATGT
GTGTAGTTACAAAGGAATTTTCTGCTCAAACTCTCAAGATTACATGGGCAACCCAACAGACCCAGTTGTTACAGATTTTCAGGXTATAAT
TCCACAAACATTCAGAGATCTGTCTTCACTCGTTGAATTAGACCTTAGTAACAACCATTTCTCAGGTCCATTCCCTACTACAGTACTATT
CATCCCAAATCTTCTTTATTTAGATCTCAGATTCAACAGTTTCACAGGCCCAATTCCCGAGGATCTGTTCAACAGAAAACTTGATGCTAT
TTTTCTTAATAATAACCAGTTTGATGGTGAACTACCTCAGAGTTTAGGGAATTTCCCCTGCTCAGTCATTAATTTTGCTAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan