ESTScan Details for Unigene SGN-U213460

Score 
1017
Direction 
Forward
Predicted Peptide Sequence 
GLWLMLGSDRLIAALATFTVLSSPIISVAIRDXNTCQRNSNGGGKNHGISQQHFNGFAPIERSITKAQQFQPLLQKRTGAKEASFHLQCN
LQSPDSDYEEGQPETLDYRVFFADNSGKKISPWHDIPLHLGDGVFNFVVEIPKESSAKMEVATDEQHTPIKQDTKKGKLRYYPYNIHWNY
GLLPQTWEDPTFANTEVEGALGDNDPVDVVEIGDSRGKIGQVLKVKPLAALAMIDEGELDWKIVAISLDDPRASLVNDVDDVEKHFPGTL
TAIRDWFRDYKIPDGKPANRFALGNKPANKDYALKIITETNESWAKLVKRSIAAGELSLXIVINRALKPPACNLNWTWKMSP
Predicted Coding Sequence 
XXTGGACTGTGGTTGATGTTAGGCAGTGATAGGCTGATAGCAGCACTAGCAACTTTCACTGTTTTATCTTCTCCAATAATTTCTGTTGCC
ATTAGGGACXTGAACACTTGCCAGCGAAACAGCAATGGCGGCGGCAAGAATCATGGTATCAGCCAGCAACACTTTAACGGCTTCGCTCCT
ATCGAAAGGTCCATTACGAAGGCCCAACAATTTCAGCCTTTGCTTCAGAAACGGACCGGTGCAAAAGAAGCGTCTTTTCACTTGCAGTGC
AATCTACAATCCCCAGATTCAGACTATGAAGAAGGACAGCCAGAAACCCTAGATTACCGCGTGTTTTTTGCAGACAATTCCGGCAAAAAG
ATATCCCCTTGGCATGACATACCACTACATTTGGGTGATGGTGTTTTCAATTTTGTTGTTGAGATCCCCAAAGAATCAAGTGCAAAGATG
GAAGTTGCTACAGATGAGCAACACACTCCTATTAAACAAGACACAAAGAAGGGGAAACTTCGATACTATCCATATAATATTCACTGGAAC
TATGGATTGCTTCCTCAAACATGGGAAGATCCTACTTTTGCGAATACCGAAGTTGAAGGGGCATTAGGTGATAATGACCCTGTTGATGTT
GTTGAGATTGGGGATAGCCGAGGTAAAATTGGCCAGGTTCTGAAGGTCAAACCTTTAGCTGCTCTGGCAATGATTGATGAAGGAGAACTT
GACTGGAAAATAGTTGCTATTTCACTAGATGATCCAAGAGCTTCACTTGTTAATGATGTTGATGATGTGGAAAAACATTTTCCGGGCACT
CTCACAGCAATCAGGGACTGGTTTAGAGACTATAAGATACCTGATGGAAAACCTGCTAATAGGTTTGCTCTTGGCAACAAGCCAGCAAAC
AAGGATTACGCTCTTAAGATTATTACGGAAACCAATGAATCTTGGGCAAAGCTGGTCAAGAGATCAATCGCTGCTGGTGAGCTTTCACTT
GXTATAGTGATTAATAGAGCTCTTAAGCCTCCTGCTTGTAACCTAAACTGGACATGGAAAATGTCCCCATGA\
Edits in Original Sequence 
(5')XXTGGACTGTGGTTGATGTTAGGCAGTGATAGGCTGATAGCAGCACTAGCAACTTTCACTGTTTTATCTTCTCCAATAATTTCTGT
TGCCATTAGGGACXTGAACACTTGCCAGCGAAACAGCAATGGCGGCGGCAAGAATCATGGTATCAGCCAGCAACACTTTAACGGCTTCGC
TCCTATCGAAAGGTCCATTACGAAGGCCCAACAATTTCAGCCTTTGCTTCAGAAACGGACCGGTGCAAAAGAAGCGTCTTTTCACTTGCA
GTGCAATCTACAATCCCCAGATTCAGACTATaGAAGAAGGACAGCCAGAAACCCTAGATTACCGCGTGTTTTTTGCAGACAATTCCGGCA
AAAAGATATCCCCTTGGCATGACATACCACTACATTTGGGTGATGGTGTTTTCAATTTTGTTGTTGAGATCCCCAAAGAATCAAGTGCAA
AGATGGAAGTTGCTACAGATGAGCAACACACTCCTATTAAACAAGACACAAAGAAGGGGAAACTTCGATACTATCCATATAATATTCACT
GGAACTATGGATTGCTTCCTCAAACATGGGAAGATCCTACTTTTGCGAATACCGAAGTTGAAGGGGCATTAGGTGATAATGACCCTGTTG
ATGTTGTTGAGATTGGGGATAGCCGAGGTAAAATTGGCCAGGTTCTGAAGGTCAAACCTTTAGCTGCTCTGGCAATGATTGATGAAGGAG
AACTTGACTGGAAAATAGTTGCTATTTCACTAGATGATCCAAGAGCTTCACTTGTTAATGATGTTGATGATGTGGAAAAACATTTTCCGG
GCACTCTCACAGCAATCAGGGACTGGTTTAGAGACTATAAGATACCTGATGGAAAACCTGCTAATAGGTTTGCTCTTGGCAACAAGCCAG
CAAACAAGGATTACGCTCTTAAGATTATTACGGAAACCAATGAATCTTGGGCAAAGCTGGTCAAGAGATCAATCGCTGCTGGTGAGCTTT
CACTTGXTATAGTGATTAATAGAGCTCTTAAGCCTCCTGCTTGTAACCTAAACTGGACATGGAAAATGTCCCCATGA\(3')TTGTACTC
TTTCGTCTGGGGTGGAAGCCAATTCATATTTTAAAGAAAGACTTCTTTGTTATAAGCTACTGTTTTTCATTTATCATCAATAATTTTGTT
CATCCAGTAGCATTTGTAAGTTATCCAGAACGAAAACAAGTGTATTGACATATGATTTAATCTTCATTCTCCAGATGCATCAATTGAAAA
TTAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan