ESTScan Details for Unigene SGN-U213614

Score 
339
Direction 
Reverse
Predicted Peptide Sequence 
LLASLFQTLMARDLISDGIEVLQLPVENDGEFVFCPGKQSWPELVGKSARYAKQVIQKENPIVTQFTLLFPGMPKPAAYICGRVYLVVNW
KLIVQVTPSMG
Predicted Coding Sequence 
CTTCTTGCATCACTTTTTCAAACACTGATGGCAAGAGATTTGATCAGTGATGGCATAGAAGTGCTACAACTTCCAGTGGAAAATGATGGT
GAATTTGTATTTTGCCCAGGTAAGCAATCATGGCCTGAACTTGTTGGAAAATCAGCAAGATATGCAAAACAAGTAATTCAGAAGGAAAAT
CCAATAGTAACTCAATTTACACTTTTATTTCCTGGTATGCCTAAGCCAGCAGCATATATTTGTGGTAGAGTTTATTTGGTTGTTAACTGG
AAACTCATTGTTCAAGTTACTCCCTCTATGGGTTAG\
Edits in Original Sequence 
(5')CTTCTTGCATCACTTTTTCAAACACTGATGGCAAGAGATTTGATCAGTGATGGCATAGAAGTGCTACAACTTCCAGTGGAAAATGA
TGGTGAATTTGTATTTTGCCCAGGTAAGCAATCATGGCCTGAACTTGTTGGAAAATCAGCAAGATATGCAAAACAAGTAATTCAGAAGGA
AAATCCAATAGTAACTCAATTTACACTTTTATTTCCTGGTATGCCTAAGCCAGCAGCATATATTTGTGGTAGAGTTTATTTGGTTGTTAA
CTGGAAACTCATTGTTCAAGTTACTCCCTCTATGGGTTAG\(3')TAACATTATGTTATCAAAAAATTAAATGAAGTCTCTTCATTTACT
CTACTATTTCAACATAAATAAAACTAATGTTCCTTACAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan