ESTScan Details for Unigene SGN-U213663

Score 
235
Direction 
Forward
Predicted Peptide Sequence 
PYITFTFPSTNSTSKISTFDAQLLSGDGSDLDPDNALSLQLHHVDLVSPSSFNATPHALFKLRLQRDAYRAKAISDLASANATVGRRAGK
PHPGGRDFSSSVVSGLSQGSGEYFTRIGVGTPSKYVYMVLDREVTSFGSSVRLVKSATLNPDPVFDPSKSSSFLGVACGSPLCRRLDSGS
CNRKKCLYQVSYGDGSFTVGDFSTETLTFRGTRVNNVALGCGHDNEGLFVGAAGLLGLGRGRLSFPTQAGRRFGRKFSYCLVDRSASSKP
SYLVFGESAVSRTAVFTPLVKNPKLDTFYYVELTGFSVGGARVPAIRPSLFKLDAAGDGGVIVDSGTSVTRLTRPAYVALRDAFRMGAKD
LKRAPDFSLFDTCFDLSGKTEVKVPTVVMHFRGADVSLPASNYLIPVDSDGTFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGNRLGFAP
RGCA
Predicted Coding Sequence 
CCATACATTACTTTTACATTCCCTTCCACTAACTCAACTTCAAAAATCTCTACATTTGATGCTCAACTACTTTCCGGCGATGGCTCCGAC
CTCGATCCGGATAATGCTCTCTCTCTACAGTTGCATCATGTAGACTTAGTATCTCCTTCGTCCTTCAATGCTACACCACATGCGCTGTTT
AAGCTCCGTCTACAACGTGACGCCTATAGAGCTAAGGCAATTTCTGACCTCGCCTCTGCTAACGCCACCGTTGGACGCCGTGCGGGTAAG
CCTCATCCTGGTGGTAGGGATTTCTCTAGTTCTGTTGTTTCTGGACTGTCTCAGGGGAGTGGAGAGTATTTCACGCGAATCGGTGTTGGT
ACTCCTTCTAAGTATGTTTATATGGTGTTGGATAGGGAAGTGACGTCGTTTGGATCCAGTGTTCGCCTTGTAAAAAGTGCTACACTCAAT
CCXGACCCGGTTTTTGACCCGAGTAAATCGTCTTCCTTCCTTGGTGTTGCATGTGGGTCGCCTTTGTGTCGTAGGTTGGATTCTGGTAGC
TGTAACCGAAAGAAATGTCTTTATCAGGTTTCTTACGGAGACGGTTCTTTCACCGTCGGCGATTTTTCAACTGAAACGTTAACTTTCAGG
GGGACACGCGTGAACAACGTGGCCCTTGGATGCGGCCACGATAACGAAGGTTTATTCGTCGGAGCCGCTGGTTTACTGGGTCTCGGCCGG
GGTAGACTATCATTTCCGACTCAAGCTGGTCGGAGATTCGGCAGAAAATTCTCCTACTGCCTTGTCGACCGGTCCGCTTCCTCTAAACCA
TCCTATCTAGTCTTCGGCGAATCTGCAGTTTCTCGAACCGCTGTGTTTACCCCACTCGTCAAAAACCCAAAACTAGACACGTTTTACTAC
GTGGAGCTCACCGGATTCAGCGTCGGCGGCGCTAGGGTTCCTGCAATCAGGCCGTCGCTGTTCAAGCTAGACGCCGCTGGTGATGGTGGT
GTGATAGTAGATTCAGGAACTTCAGTGACCCGATTGACCCGACCCGCTTACGTAGCTCTGAGGGACGCTTTCCGAATGGGTGCTAAAGAT
CTGAAAAGAGCACCCGATTTCTCATTGTTCGATACATGTTTCGATCTATCAGGGAAAACGGAAGTGAAGGTTCCGACAGTGGTTATGCAT
TTCCGTGGAGCTGACGTGTCATTGCCGGCGTCAAATTACTTGATTCCGGTGGACAGTGATGGGACATTCTGCTTTGCATTTGCCGGTACA
ATGAGTGGATTGTCGATTATCGGAAACATTCAGCAGCAAGGTTTCAGGGTAGTGTTCGATCTTGCTGGGAATCGCCTAGGCTTTGCTCCT
CGTGGGTGCGCTTAA\
Edits in Original Sequence 
AGAGAGCAAATATCCACCGTCTCTGTCTCCATTATTTAAACTCCCAATGCCCAACCCTTCCCTTCCCACTTTCACTTCCCCTGTTTTTCT
GTTTAAAAAAAAAAATGGAAGGAAAAACTATTTCCCTTTCCTTCCTTTTACTTTCTCTCTTAGCCATTTCTGTCTCTTCCACTTCTCTTC
AATA
(5')CCATACATTACTTTTACATTCCCTTCCACTAACTCAACTTCAAAAATCTCTACATTTcGATGCTCAACTACTTTCCGGCGAT
GGCTCCGACCTCGATCCGGATAATGCTCTCTCTCTACAGTTGCATCATGTAGACTTAGTATCTCCTTCGTCCTTCAATGCTACACCACAT
GCGCTGTTTAAGCTCCGTCTACAACGTGACGCCTATAGAGCTAAGGCAATTTCTGACCTCGCCTCTGCTAACGCCACCGTTGGACGCCGT
GCGGGTAAGCCTCATCCTGGTGGTAGGGATTTCTCTAGTTCTGTTGTTTCTGGACTGTCTCAGGGGAGTGGAGAGTATTTCACGCGAATC
GGTGTTGGTACTCCTTCTAAGTATGTTTATATGGTGTTGGATAcGGGAAGTGACGTCGTTTGGATCCAGTGTTCGCCTTGTAAAAAGTGC
TACACTCAATCCXGACCCGGTTTTTGACCCGAGTAAATCGTCTTCCTTCCTTGGTGTTGCATGTGGGTCGCCTTTGTGTCGTAGGTTGGA
TTCTGGTAGCTGTAACCGAAAGAAATGTCTTTATCAGGTTTCTTACGGAGACGGTTCTTTCACCGTCGGCGATTTTTCAACTGAAACGTT
AACTTTCAGGGGGACACGCGTGAACAACGTGGCCCTTGGATGCGGCCACGATAACGAAGGTTTATTCGTCGGAGCCGCTGGTTTACTGGG
TCTCGGCCGGGGTAGACTATCATTTCCGACTCAAGCTGGTCGGAGATTCGGCAGAAAATTCTCCTACTGCCTTGTCGACCGGTCCGCTTC
CTCTAAACCATCCTATCTAGTCTTCGGCGAATCTGCAGTTTCTCGAACCGCTGTGTTTACCCCACTCGTCAAAAACCCAAAACTAGACAC
GTTTTACTACGTGGAGCTCACCGGATTCAGCGTCGGCGGCGCTAGGGTTCCTGCAATCAGGCCGTCGCTGTTCAAGCTAGACGCCGCTGG
TGATGGTGGTGTGATAGTAGATTCAGGAACTTCAGTGACCCGATTGACCCGACCCGCTTACGTAGCTCTGAGGGACGCTTTCCGAATGGG
TGCTAAAGATCTGAAAAGAGCACCCGATTTCTCATTGTTCGATACATGTTTCGATCTATCAGGGAAAACGGAAGTGAAGGTTCCGACAGT
GGTTATGCATTTCCGTGGAGCTGACGTGTCATTGCCGGCGTCAAATTACTTGATTCCGGTGGACAGTGATGGGACATTCTGCTTTGCATT
TGCCGGTACAATGAGTGGATTGTCGATTATCGGAAACATTCAGCAGCAAGGTTTCAGGGTAGTGTTCGATCTTGCTGGGAATCGCCTAGG
CTTTGCTCCTCGTGGGTGCGCTTAA\(3')ATTAACGAGAGATTATTATAAAATTGCTTCCAAATTCCCCAGTTTATTATATGTTTGATG
ATTTTTCTTTGGTTTGGGGTGTATTAGGAGAAGATAAAGGAACATGATTAGATGTTGTGTGTTTGTATTATGTGTTGTAATACAGGGTTA
AGAGTATGTAGTGATAATTAGTGTAGATTTGTAACTCAAAACACTCTGTTTTCTGTAAGATGGGGCGAGGTTGATAGTAGCTGCAAAATG
TGCGGCGCTGCTTAAACTTGCTATTGATTTATATATTTTTCTTTTTATGTTTTCAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan