ESTScan Details for Unigene SGN-U213694

Score 
515
Direction 
Reverse
Predicted Peptide Sequence 
VVTKLQVENHVFPPTMVNPLGSNNMFFLAGAGNRGLEIEGKFVKFTAIGVYLEESAIPFLADKWKGKSSEELEHSVEFFRDIVTGPFEKF
TRXDYDLALDGKQYSEKVAENCVAYWKAIGTYSDAEMQAIEKFLDVFQSETFPPGASILFTQSPLGSLTISFSEDDSVPCVGNAVIENKQ
LSEAVLDSIIGEHGVSPAAKCSIAKRVSELLVCEKPGSXAIVSPVTGLQKSKRNRPCQKVELLRTIKELSGAETPLSTRSNVSRYLEDIR
QMILA
Predicted Coding Sequence 
XCGGTTGTTACAAAATTGCAGGTAGAGAATCACGTGTTCCCACCAACAATGGTGAATCCTCTGGGCTCCAACAATATGTTTTTTCTCGCC
GGCGCAGGGAATAGAGGTTTGGAGATTGAAGGAAAATTTGTGAAGTTTACTGCGATCGGTGTGTACTTGGAAGAGAGTGCTATTCCATTT
CTAGCTGATAAATGGAAAGGGAAAAGCTCTGAGGAGTTGGAACATTCAGTCGAATTCTTCAGGGATATCGTTACAGGTCCATTTGAGAAA
TTCACTCGAGXTGACTATGATCTTGCCCTTGACGGGAAGCAATACTCTGAGAAGGTAGCAGAAAATTGTGTTGCATATTGGAAAGCAATA
GGAACCTACAGTGATGCAGAGATGCAGGCCATTGAGAAGTTCCTCGATGTTTTCCAGAGTGAAACCTTCCCACCTGGTGCCTCCATCCTT
TTTACTCAATCACCGCTTGGATCATTGACAATTAGCTTCTCTGAAGATGATTCAGTTCCTTGTGTTGGGAATGCTGTTATAGAGAACAAA
CAATTGTCAGAAGCAGTGCTGGATTCCATAATTGGCGAGCACGGAGTTTCCCCTGCAGCAAAGTGTAGTATTGCAAAAAGAGTATCAGAA
CTGTTGGTTTGTGAAAAACCAGGAAGTGXAGCTATCGTCAGTCCAGTAACTGGACTACAGAAATCGAAGAGAAATAGACCATGTCAGAAA
GTGGAGCTACTTAGGACAATAAAAGAGCTTTCTGGTGCTGAAACGCCCTTGTCAACTCGGTCTAATGTGTCAAGGTATCTTGAGGATATT
AGACAAATGATTTTAGCCTAG\
Edits in Original Sequence 
(5')XCGGTTGTTACAAAATTGCAGGTAGAGAATCACGTGTTCCCACCAACAATGGTGAATCCTCTGGGCTCCAACAATATGTTTTTTCT
CGCCGGCGCAGGGAATAGAGGTTTGGAGATTGAAGGAAAATTTGTGAAGTTTACTGCGATCGGTGTGTACTTGGAAGAGAGTGCTATTCC
ATTTCTAGCTGATAAATGGAAAGGGAAAAGCTCTGAGGAGTTGGAACATTCAGTCGAATTCTTCAGGGATATCGTTACAGGTCCATTTGA
GAAATTCACTCGAGXTGACTATGATCTTGCCCTTGACGGGtAAGCAATACTCTGAGAAGGTAGCAGAAAATTGTGTTGCATATTGGAAAG
CAATAGGAACCTACAGTGATGCAGAGATGCAGGCCATTGAGAAGTTCCTCGATGTTTTCCAGAGTGAAACCTTCCCACCTGGTGCCTCCA
TCCTTTTTACTCAATCACCGCTTGGATCATTGACAATTAGCTTCTCTGAAGATGATTCAGTTCCTTGTGTTGGGAATGCTGTTATAGAGA
ACAAACAATTGTCAGAAGCAGTGCTGGATTCCATAATTGGCGAGCACGGAGTTTCCCCTGCAGCAAAGTGTAGTATTGCAAAAAGAGTAT
CAGAACTGTTGGTTTGTGAAAAACCAGGAAGTGXAGCTATCGTCAGTCCAGTAACTGGACTACAGAAATCGAAGAGAAATAGACCATGTC
AGAAAGTGGAGtCTACTTAGGACAATAAAAGAGCTTTCTGGTGCTGAAACGCCCTTGTCAACTCGGTCTAATGTGTCAAGGTATCTTGAG
GATATTAGACAAATGATTTTAGCCTAG\(3')CTTTTCTACTATGCAATAGTGTGCAATAAGGTCCCACTTTAAGTCTGTTAATTATGTA
AATGTGAGAGATTCAAAATGCCTTTGTTGAATTTATATCAATGTTCTTTGAAGAGTATTTTCTTACCATTTGAATTGTGAGTGATATGTG
ACTGCAGTAATGAGAATATGTTGGATGTTGAATATATATATATATATATATATTTTTATTTTTTTTTTTTTAGCAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan