ESTScan Details for Unigene SGN-U213709

Score 
2379
Direction 
Forward
Predicted Peptide Sequence 
MASRSSIRLISYSNEIINGEPIYISSNCYPIKAHKYEPAGLAFHSAALRLIGHVEKEDPKDGKEDVPNDKEQTFAYSSESYSSKGKKKSS
TGEKVQDHYALLGLSNLRYLASEDQIRKSYRDAALRHHPDKLASLLLAEETEAAKQAKKEEIENHFKAIQEAYEVLMDPVRRRIYDSTDE
FDDEIPTECAPQDFFKVFGPAFLRNGRWSVTQPIPSLGDENTPIKEVDSFYNFWYSFKSWREFPHADEFDLEQAESRDHKRWMERQNAKL
SEKARKEETARVRTLVDNAYRKDPRILGRKEAEKAEKQRKKDAKLLAKKLQEAEAIRIVEEDKRKKEEEEKRAAEVALQQKKLKEKEKKL
LRKERSRLRTLAAPVLSQRLLGLNDDDVEGLCMSLDIEQLRNLCDKADGQGEIVIAELLRGALGHEHNLKYENKDEKIKSQQNGSLDSKK
QVPLMSSEKKEKPWSKEEIDLLRKGMLKYPKGTSRRWEVISDYIGTARTVEEILKATKTVLLQKPDSAKAFDSFLEKRKPAPTIVSPLST
RAEVEGVENSSKPESGSAKVADSQETPSQNTNSQNTEDAPTANGVSSSSDSDVWSAVQEKALVQALKTFPKETSQRWERVATAVPGKTMN
QCKKKFXITQREFQEQEKCSVRLVVLETAESSFFLLFLFSIVQAAXNKLTLVMHCDNTPHPSPFSVPFLSLSSSIYISTIQYGIVKLLYL
NTVIFDGKH
Predicted Coding Sequence 
ATGGCTTCCAGGAGTAGCATCCGTCTTATTTCATACTCGAATGAGATTATAAATGGTGAACCAATCTATATTTCCTCTAACTGCTATCCT
ATTAAAGCTCACAAATATGAGCCTGCTGGGCTTGCTTTTCACTCTGCTGCTCTTAGACTAATTGGGCATGTTGAGAAAGAAGACCCCAAA
GATGGCAAAGAAGATGTTCCTAATGACAAGGAACAGACATTTGCCTATTCATCAGAGTCATACAGCTCTAAGGGGAAGAAGAAGTCTTCT
ACCGGCGAAAAGGTACAAGATCATTATGCATTATTAGGGTTGAGCAATCTAAGGTATCTTGCTTCTGAGGATCAGATAAGGAAGAGCTAT
CGTGATGCTGCATTGAGGCATCATCCTGACAAGCTGGCTTCACTTCTTCTAGCTGAGGAAACTGAAGCTGCAAAACAAGCCAAGAAGGAG
GAAATAGAAAACCACTTCAAAGCTATTCAGGAAGCATATGAGGTTCTTATGGACCCTGTTAGGAGAAGGATTTATGACTCCACGGATGAA
TTTGATGATGAAATCCCAACTGAATGTGCTCCACAAGATTTTTTTAAGGTCTTTGGACCTGCATTTTTAAGGAATGGTCGTTGGTCCGTC
ACCCAACCCATCCCTTCATTAGGTGATGAGAATACTCCAATTAAAGAAGTGGATAGCTTTTATAATTTCTGGTACAGCTTCAAAAGTTGG
AGAGAGTTCCCACATGCTGATGAGTTTGATCTTGAACAAGCTGAATCTCGTGATCACAAGAGGTGGATGGAAAGGCAGAATGCAAAACTT
TCAGAGAAAGCCAGAAAGGAAGAAACCGCCAGGGTGCGTACACTTGTTGACAATGCCTATAGAAAAGACCCTAGAATCTTAGGAAGAAAA
GAGGCGGAGAAAGCAGAGAAGCAGAGAAAGAAGGACGCTAAACTACTTGCAAAGAAATTACAGGAGGCAGAAGCAATTAGGATTGTTGAA
GAGGACAAGCGTAAGAAAGAGGAAGAGGAGAAAAGAGCAGCTGAAGTTGCTTTGCAGCAGAAGAAGTTGAAGGAGAAAGAAAAGAAATTG
TTGCGAAAAGAGCGTAGTCGTTTAAGAACCCTTGCTGCTCCTGTTCTGTCTCAGCGTTTGCTTGGGCTAAATGATGACGATGTAGAAGGT
CTATGCATGTCACTTGACATTGAGCAACTGAGGAACTTATGTGATAAAGCCGATGGACAGGGTGAGATTGTTATTGCTGAACTTCTTAGG
GGGGCACTTGGACATGAACACAACCTGAAATATGAGAATAAAGATGAAAAGATTAAGTCGCAGCAAAATGGTTCTCTGGACAGTAAAAAA
CAAGTTCCTCTGATGAGCAGTGAGAAAAAAGAGAAACCTTGGAGCAAAGAAGAAATTGATCTTTTGAGGAAGGGGATGCTGAAATATCCT
AAAGGAACTTCTCGAAGATGGGAAGTTATTTCTGATTATATTGGTACCGCAAGGACAGTTGAAGAGATCCTGAAGGCTACAAAAACAGTT
CTGCTCCAGAAGCCCGACTCTGCTAAAGCCTTTGACTCCTTCCTTGAGAAAAGAAAGCCTGCACCAACTATTGTTTCTCCTCTTTCCACG
AGGGCAGAAGTAGAGGGAGTAGAAAATAGTAGCAAGCCTGAAAGTGGAAGCGCCAAAGTAGCTGATTCTCAGGAGACCCCTAGTCAAAAC
ACAAACAGCCAGAACACTGAGGATGCACCTACAGCAAACGGAGTTTCTTCGAGTTCTGATTCAGACGTATGGTCTGCTGTTCAAGAAAAA
GCCTTAGTTCAAGCTCTGAAAACCTTCCCCAAGGAAACCAGCCAGCGGTGGGAACGAGTGGCAACTGCTGTCCCTGGGAAGACTATGAAC
CAGTGTAAAAAAAAGTTTGXCATTACTCAAAGAGAATTTCAGGAGCAAGAAAAGTGCAGTGTGAGGTTAGTGGTGCTTGAAACTGCTGAG
TCTAGTTTTTTTCTTTTATTTCTATTTTCTATTGTTCAGGCAGCCXGCAACAAGCTCACTCTTGTAATGCATTGTGACAACACCCCACAC
CCCAGTCCATTTTCAGTACCATTTTTGTCATTAAGCAGTAGCATTTACATATCTACTATTCAGTACGGCATTGTGAAGTTACTATACTTG
AATACAGTAATATTTGATGGGAAACACTGA\
Edits in Original Sequence 
TTTGAGGCAGCTGAGTTCCGCAGACTAAAACCCTAGCTCCTCCCTCTCCTTCAACCGTCGTCACGCCGCTCTCTTTTCGTAAACACATAA
CTTTTAACCCCCTTTTTTAGATCATCCTCCATAATCAGTAACACAATTAGATTATCGGAAAAGGCTTGGAGAGTGTAGAAGGCTGCTTTT
ATTGGCTCTTGCCCCAAGTGTAGCTGTTGGTGGATGCGTTCTTATTCATCTTCTATAGTTGAGGGCTAAGTTTTCTCT
(5')ATGGCTTC
CAGGAGTAGCATCCGTCTTATTTCATACTCGAATGAGATTATAAATGGTGAACCAATCTATATTTCCTCTAACTGCTATCCTATTAAAGC
TCACAAATATGAGCCTGCTGGGCTTGCTTTTCACTCTGCTGCTCTTAGACTAATTGGGCATGTTGAGAAAGAAGACCCCAAAGATGGCAA
AGAAGATGTTCCTAATGACAAGGAACAGACATTTGCCTATTCATCAGAGTCATACAGCTCTAAGGGGAAGAAGAAGTCTTCTACCGGCGA
AAAGGTACAAGATCATTATGCATTATTAGGGTTGAGCAATCTAAGGTATCTTGCTTCTGAGGATCAGATAAGGAAGAGCTATCGTGATGC
TGCATTGAGGCATCATCCTGACAAGCTGGCTTCACTTCTTCTAGCTGAGGAAACTGAAGCTGCAAAACAAGCCAAGAAGGAGGAAATAGA
AAACCACTTCAAAGCTATTCAGGAAGCATATGAGGTTCTTATGGACCCTGTTAGGAGAAGGATTTATGACTCCACGGATGAATTTGATGA
TGAAATCCCAACTGAATGTGCTCCACAAGATTTTTTTAAGGTCTTTGGACCTGCATTTTTAAGGAATGGTCGTTGGTCCGTCACCCAACC
CATCCCTTCATTAGGTGATGAGAATACTCCAATTAAAGAAGTGGATAGCTTTTATAATTTCTGGTACAGCTTCAAAAGTTGGAGAGAGTT
CCCACATGCTGATGAGTTTGATCTTGAACAAGCTGAATCTCGTGATCACAAGAGGTGGATGGAAAGGCAGAATGCAAAACTTTCAGAGAA
AGCCAGAAAGGAAGAAACCGCCAGGGTGCGTACACTTGTTGACAATGCCTATAGAAAAGACCCTAGAATCTTAGGAAGAAAAGAGGCGGA
GAAAGCAGAGAAGCAGAGAAAGAAGGACGCTAAACTACTTGCAAAGAAATTACAGGAGGCAGAAGCAATTAGGATTGTTGAAGAGGACAA
GCGTAAGAAAGAGGAAGAGGAGAAAAGAGCAGCTGAAGTTGCTTTGCAGCAGAAGAAGTTGAAGGAGAAAGAAAAGAAATTGTTGCGAAA
AGAGCGTAGTCGTTTAAGAACCCTTGCTGCTCCTGTTCTGTCTCAGCGTTTGCTTGGGCTAAATGATGACGATGTAGAAGGTCTATGCAT
GTCACTTGACATTGAGCAACTGAGGAACTTATGTGATAAAGCCGATGGACAGGGTGAGATTGTTATTGCTGAACTTCTTAGGGGGGCACT
TGGACATGAACACAACCTGAAATATGAGAATAAAGATGAAAAGATTAAGTCGCAGCAAAATGGTTCTCTGGACAGTAAAAAACAAGTTCC
TCTGATGAGCAGTGAGAAAAAAGAGAAACCTTGGAGCAAAGAAGAAATTGATCTTTTGAGGAAGGGGATGCTGAAATATCCTAAAGGAAC
TTCTCGAAGATGGGAAGTTATTTCTGATTATATTGGTACCGCAAGGACAGTTGAAGAGATCCTGAAGGCTACAAAAACAGTTCTGCTCCA
GAAGCCCGACTCTGCTAAAGCCTTTGACTCCTTCCTTGAGAAAAGAAAGCCTGCACCAACTATTGTTTCTCCTCTTTCCACGAGGGCAGA
AGTAGAGGGAGTAGAAAATAGTAGCAAGCCTGAAAGTGGAAGCGCCAAAGTAGCTGATTCTCAGGAGACCCCTAGTCAAAACACAAACAG
CCAGAACACTGAGGATGCACCTACAGCAAACGGAGTTTCTTCGAGTTCTGATTCAGACGTATGGTCTGCTGTTCAAGAAAAAGCCTTAGT
TCAAGCTCTGAAAACCTTCCCCAAGGAAACCAGCCAGCGGTGGGAACGAGTGGCAACTGCTGTCCCTGGGAAGACTATGAACCAGTGTAA
AAAAAAGTTTGXCATTACTCAAAGAGAATTTCAGGAGCAAGAAAAGTGCAGTGTGAGGTTAGTGGTGCTTGAAACTGCTGAGTCTAGTTT
TTTTCTTTTATTTCTATTTTCTATTGTTCAGGCAGCCXGCAACAAGCTCACTCTTGTAATGCATTGTGACAACACCCCACACCCCAGTCC
ATTTTCAGTACCATTTTTGTCATTAAGCAGTAGCATTTACATATCTACTATTCAGTACGGCATTGTGAAGTTACTATACTTGAATACAGT
AATATTTGATGGGAAACACTGA\(3')TGATATCTAAAAAAAAAAAAAAAAAAATTTAAAAAAAAAAAAAAAANTCCGGGGGGGGGGGCC
GGGCCCCCATTCCCCCTAAGGGGGGGGTAAATAAAATTTCGGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan