Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U213908

Score 
797
Direction 
Forward
Predicted Peptide Sequence 
TAVSSAAHPCPYIAYVGIHPSSSNSSGSINDGPNFNNHWTSPSVPNEIPASYAFPGMDVHYHSWDHHSSFPMASSRVGTADQSSVPSVTQ
RVARTNADIPRPGSFVPPFLVGHGSAARAGSSVASPMIPPYPGSVARARDRVQALQAYFQQPSNSPAVRTPVMSATRRSNNHRGLAQVGP
AASSSDQAGGFYFYPSSSSGRNFQEAENPVSNRYHAWEREHLPAFPLSQVDRDPIWGPFHHTGVGSDSGSRAGSFRPDMGLKDAVPEPVM
NFCAVLMRTVITLNEPNXMYVLRKRSKMVGVLSIWQVQNCFVAMKSDPFLMAMSCVMGPWRSLVSVLWGINNIXNVNGKVQASDLPLYLQ
CLVTHISVILVNGLNIDEPVECSFGQXEPVVQIGSTVEATTASFMGDKEXKAIRLF
Predicted Coding Sequence 
ACAGCTGTATCATCTGCTGCTCATCCATGCCCGTATATTGCCTATGTTGGAATTCACCCATCATCCTCAAATTCGAGTGGAAGTATCAAT
GATGGTCCTAATTTCAACAATCACTGGACTAGTCCATCTGTTCCCAACGAGATACCTGCTTCTTATGCTTTCCCAGGAATGGATGTGCAT
TATCATAGTTGGGATCATCATTCTTCTTTCCCTATGGCAAGCAGTCGTGTTGGTACTGCTGATCAGTCCTCGGTTCCCTCTGTTACTCAG
AGAGTTGCCAGGACCAATGCTGATATCCCAAGACCAGGATCTTTTGTCCCTCCATTCCTTGTTGGTCACGGTTCTGCTGCCAGAGCTGGA
AGTTCAGTTGCTTCACCAATGATACCTCCTTATCCTGGAAGTGTAGCTCGGGCTCGTGACCGTGTTCAAGCTCTTCAAGCCTATTTTCAG
CAACCAAGTAATTCACCAGCTGTACGCACTCCTGTTATGTCTGCTACTCGACGATCCAACAATCACAGAGGGTTGGCTCAAGTGGGGCCG
GCTGCCTCATCATCTGATCAGGCTGGTGGCTTCTACTTCTATCCTTCAAGTTCTTCAGGAAGAAATTTCCAAGAAGCAGAAAATCCAGTA
TCAAACAGATATCACGCTTGGGAACGAGAACACTTGCCCGCCTTCCCCTTGAGTCAGGTTGACAGAGATCCTATTTGGGGGCCATTTCAT
CACACAGGTGTTGGATCTGATAGTGGTAGCCGAGCTGGCAGCTTCCGACCAGACATGGGTCTGAAGGATGCCGTCCCAGAACCGGTCATG
AACTTCTGTGCTGTTTTGATGAGAACTGTGATTACTTTGAATGAACCCAATTTXATGTATGTTTTGAGAAAACGATCTAAAATGGTTGGA
GTCTTGTCAATTTGGCAGGTTCAAAACTGTTTCGTGGCCATGAAAAGTGATCCCTTTCTGATGGCCATGAGTTGTGTGATGGGACCGTGG
CGCTCTCTTGTTTCTGTGCTGTGGGGTATAAATAACATCAXCAATGTTAATGGCAAAGTTCAAGCTAGTGATTTGCCTCTTTATCTGCAG
TGCTTGGTTACCCATATTTCTGTCATATTAGTAAATGGTTTGAACATTGATGAACCTGTTGAATGTAGTTTTGGTCAACAXGAACCTGTT
GTTCAGATTGGTTCTACGGTTGAAGCAACCACTGCATCCTTTATGGGTGACAAAGAAXTTAAAGCTATTAGACTGTTTTAA\
Edits in Original Sequence 
(5')ACAGCTGTATCATCTGCTGCTCATCCATGCCCGTATATTGCCTATGTTGGAATTCACCCATCATCCTCAAATTCGAGTGGAAGTAT
CAATGATGGTCCTAATTTCAACAATCACTGGACTAGTCCATCTGTTCCCAACGAGATACCTGCTTCTTATGCTTTCCCAGGAATGGATGT
GCATTATCATAGTTGGGATCATCATTCTTCTTTCCCTATGGCAAGCAGTCGTGTTGGTACTGCTGATCAGTCCTCGGTTCCCTCTGTTAC
TCAGAGAGTTGCCAGGACCAATGCTGATATCCCAAGACCAGGATCTTTTGTCCCTCCATTCCTTGTTGGTCACGGTTCTGCTGCCAGAGC
TGGAAGTTCAGTTGCTTCACCAATGATACCTCCTTATCCTGGAAGTGTAGCTCGGGCTCGTGACCGTGTTCAAGCTCTTCAAGCCTATTT
TCAGCAACCAAGTAATTCACCAGCTGTACGCACTCCTGTTATGTCTGCTACTCGACGATCCAACAATCACAGAGGGTTGGCTCAAGTGGG
GCCGGCTGCCTCATCATCTGATCAGGCTGGTGGCTTCTACTTCTATCCTTCAAGTTCTTCAGGAAGAAATTTCCAAGAAGCAGAAAATCC
AGTATCAAACAGATATCACGCTTGGGAACGAGAACACTTGCCCGCCTTCCCCTTGAGTCAGGTTGACAGAGATCCTATTTGGGGGCCATT
TCATCACACAGGTGTTGGATCTGATAGTGGTAGCCGAGCTGGCAGCTTCCGACCgAGACATGGGTCTGAgAGGATGCCGTCCCAGAACCG
GTCATGAACTTCTGTGCTGTTTTGATGAGAACTGTGATTACTTTGAATGAACCCAATTTXATGTATGTTTTGAGAAAACGATCTAAAATG
GTTGGAGTCTTGTCAATTTGGCAGGTTCAAAACTGTTTCGTGGCCATGAAAAGTGATCCCTTTCTGATGGCCATGAGTTGTGTGATGGGA
CCGTGGCGCTCTCTTGTTTCTGTGCTGTGGGGTATAAATAACATCAXCAATGTTAATGGCAAAGTTCAAGCTAGTGATTTGCCTCTTTAT
CTGCAGTGCTTGGTTACCCATATTTCTGTCATATTAGTAAATGGTTTGAACATTGATGAACCTGTTGAATGTAGTTTTGGTCAACAXGAA
CCTGTTGTTCAGATTGGTTCTACGGTTGAAGCAACCACTGCATCCTTTATGGGTGACAAAGAAXTTAAAGCTATTAGACTGTTTTAA\(3')
GTAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan