ESTScan Details for Unigene SGN-U213995

Score 
34
Direction 
Reverse
Predicted Peptide Sequence 
DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEVCLFILHLFFRLITGFFTIDXKMLMSTVTTKRVLYFASSALVLLFLKVNDLY
XLKSQFDQHDCDAHVAMSTDCSYMSGSRYACSGKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Predicted Coding Sequence 
XCTGATAGGCGTCAAAAGAGGCTTGTTTTTCAGGTCTGTACTGCTAAGATGAACCTAGGTGACGAGGTTGACTTGGAAGATTATGTTTCT
CGCCCTGATAAAATTAGTGCTGCTGAGGTTTGTCTCTTTATACTTCATCTATTTTTTCGACTGATAACAGGATTCTTCACTATTGATXTC
AAAATGTTGATGTCTACTGTTACAACTAAGAGAGTTCTTTATTTTGCTTCATCTGCTTTGGTCCTTCTATTTTTAAAAGTGAATGATCTT
TATAAXTTGAAGAGTCAATTTGACCAACACGACTGTGATGCACATGTTGCAATGTCTACAGATTGCAGCTATATGTCAGGAAGCAGGTAT
GCATGCAGTGGAAAGAATCGATATGTCATACTCCCCAAGGACTTTGAAAAGGGTTACAGGACCAATGTGAAGAAGCCGGACACTGACTTC
GAGTTCTATAAGTGA\
Edits in Original Sequence 
(5')XCTGATAGGCGTCAAAAGAGGCTTGTTTTTCAGGTCTGTACTGCTAAGATGAACCTAGGTGACGAGGTTGACTTGGAAGATTATGT
TTCTCGCCCTGATAAAATTAGTGCTGCTGAGGTTTGTCTCTTTATACTTCATCTATTTTTTCGACTGATAACAGGATTCTTCACTATTGA
TXTCAAAATGTTGATGTCTACTGTTACAACTAAGAGtAGTTCTTTATTTTGCTTCATCTGCTTTGGTCCTTCTATTTTTAAAAtGTGAAT
GATCTTTATAAXTTGAAGAGTCAATTTGACCAACACGACTGTGATGCACATGTTGCAATGTCTACAGATTGCAGCTATATGTCAGGAAGC
AGGTATGCATGCAGTGcGAAAGAATCGATATGTCATACTCCCCAAGGACTTTGAAAAGGGTTACAGGACCAATGTGAAGAAGCCGGACAC
TGACTTCGAGTTCTATAAGTGA\(3')TCTGTAAAAGTAGATGAGCTAATATTTTTAGAGGTTGACCTTGTACACTCAATATGAAAATTC
TTTTTAATATGTTTTTAATGGTACTGCTGGTTTGTCAAACGTCTGCTGGTTTGTACCGTTCTAGATTCCATTATTTGTTCGTTCAGAAAG
TGCAGCGTGAGCAGTCTAATTATCCATTTAAGCTGCTTAAGTATCGCATTCGAAGGGGTGTGTCTGTAGACTCTCAGTCATTTTAATGCC
GCATTCTGTGGGATGGCTAATCTCATATATAAGCTTTGCAGTAGTACATTTTCCAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan