ESTScan Details for Unigene SGN-U214014

Score 
280
Direction 
Forward
Predicted Peptide Sequence 
HGGRRDQERQPHRGWGNRDAHMQPQRGPARPFMGAPPHTSPPYIPGPMPVQPYQPPMVYSEVPPVFYFPGPFPDPLRMPMLSPVPPVFVH
VPDTQLQTRIVNQMDYYFSNENLIKDIFLRKNMDEHGWVPVTLIAGFNKVMELTDNIQLILNAARSSTVVEVQGEKLRRRNDWFNWLMPP
SVQNSTVSSPQSLPKSASDLLVENLQRVAFDDKTVTHGNVEAHLSRSSSAELSTPSISVAXEMAGQAGAQHSQSSCKSKLRVNFYVDQGL
EAIVCFFKQSMSLVFTFGDGNEGK
Predicted Coding Sequence 
XGTCATGGGGGTAGGCGTGATCAGGAACGGCAACCCCACAGAGGTTGGGGGAATAGGGATGCACACATGCAGCCGCAGAGAGGTCCAGCT
AGGCCATTCATGGGGGCCCCACCTCATACATCTCCACCTTATATACCTGGACCCATGCCTGTACAGCCCTATCAACCTCCCATGGTTTAC
TCTGAAGTTCCACCTGTATTTTATTTTCCAGGTCCATTCCCTGATCCACTCAGAATGCCTATGCTTTCTCCTGTGCCGCCTGTCTTCGTT
CATGTACCAGATACCCAGTTGCAAACTAGAATAGTGAACCAGATGGATTATTATTTCAGTAATGAGAATTTGATTAAGGACATATTCTTG
CGAAAGAACATGGATGAACATGGATGGGTTCCGGTTACACTAATAGCGGGCTTCAATAAAGTAATGGAGTTGACAGATAATATACAACTA
ATACTGAATGCTGCGAGGTCCTCTACTGTAGTAGAAGTGCAGGGTGAAAAGTTAAGGCGGAGAAATGATTGGTTTAATTGGCTCATGCCA
CCATCAGTTCAGAATTCAACAGTGTCAAGTCCTCAATCTCTACCAAAGTCTGCTTCTGATTTACTTGTTGAAAATCTCCAACGTGTTGCA
TTTGATGATAAGACTGTAACACATGGAAATGTCGAAGCACATCTTAGTAGATCATCATCTGCTGAATTAAGTACTCCATCAATTAGTGTG
GCAATXGAGATGGCTGGACAAGCTGGTGCTCAACATTCGCAGTCCAGTTGTAAATCCAAGTTAAGAGTTAATTTTTACGTCGACCAGGGG
TTGGAAGCTATTGTGTGCTTCTTCAAGCAATCAATGAGTTTAGTCTTTACATTTGGTGATGGCAATGAAGGAAAATAG\
Edits in Original Sequence 
(5')XGTCATGGGGGTAGGCGTGATCAGGAACGGCAACCCCACAGAGGTTGGGGGAATAGGGATGCACACATGCAGCCGCAGAGAGGTCC
AGCTAGGCCATTCATGGGGGCCCCACCTCATACATCTCCACCTTATATACCTGGACCCATGCCTGTACAGCCCTATCAACCTCCCATGGT
TTACTCTGAAGTTCCACCTGTATTTTATTTTCCAGGTCCATTCCCTGATCCACTCAGAATGCCTATGCTTTCTCCTGTGCCGCCTGTCTT
CGTTCATGTACCAGATACCCAGTTGCAAACTAGAATAGTGAACCAGATGGATTATTATTTCAGTAATGAGAATTTGATTAAGGACATATT
CTTGCGAAAGAACATGGATGAACATGGATGGGTTCCGGTTACACTAATAGCGGGCTTCAATAAAGTAATGGAGTTGACAGATAATATACA
ACTAATACTGAATGCTGCGAGGTCCTCTACTGTAGTAGAAGTGCAGGGTGAAAAGTTAAGGCGGAGAAATGATTGGTTTAATTGGCTCAT
GCCACCATCAGTTCAGAATTCAACAGTGTCAAGTCCTCAATCTCTACCAAAGTCTGCTTCTGATTTACTTGTTGAAAATCTCCAACGTGT
TGCATTTGATGATAAGACTGTAACACATGGAAATGTCGAAGCACATCTTAGTAGATCATCATCTGCTGAATTAAGTACTCCATCtAATTA
GTGTGGCAATXGAGATGGCTGGACAAGCTGGTGCTCAACATTCGCAGTCCAGTTGTAAATCCAAGTTaAAGAGTTAATTTTTACGTCGAC
CAGGGGTTGGAAGCTATTGTGTGCTTCTTCAAGCAATCAATGAGTTTAGTCTTTACATTTGGTGATGGCAATGAAGGAAAATAG\(3')A
CGGGGAATAAAAGAGAAGAAACAGAATTTTGAATAGAATTATAACGACTTTTAAGTAGCTTGATTTTGTTGGGGATGTATATCTTGTTTT
GTTTGGGATTTAGTATTTTGTTTTCCTTTTATGTTATGTTGTTCCTCTGTCATGGTTATTTGTTATACAGGTAGGGGGAATTTTGATTTT
ACTTCCCCCCTGAGCATTGTTTTTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAACTAGAGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan