Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U214103

Score 
706
Direction 
Forward
Predicted Peptide Sequence 
MAXPWASTFSISPDLLVMLDPKLHVHSKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSI
VGPFPTAVTNLLDLTRLDLHNNKLTGPLPSQIGRLKRLKILNVRWNKLQDVIPPEIGELKQLTHLYLSFNNFKGEIPKELANLPELRYLH
LHENHFIGRIPPELGSLQYLRHLDVGNNRLVGTIRELIRIEGCFPVLRNLYLNNNYLTGGIPAQLANLTNLEILYLSYNKMTGVIPYSIA
HIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIDENTFRPGVKPIGLHKVLELSDADFLV
Predicted Coding Sequence 
ATGGCTCXGCCATGGGCATCTACCTTCAGTATTTCTCCTGATCTTCTCGTTATGCTTGATCCGAAGCTTCACGTTCACTCTAAAACCCTG
AAACGTGACGTGAAAGCTCTGAATGAAATTAAGGCATCTCTTGGATGGAGAGTGGTGTATGCATGGGTTGGAGATGATCCTTGTGGAGAT
GGTGATTTACCTCCATGGTCTGGTGTTACATGTTCAACGCAGGGTGATTATAGAGTAGTTACTGAATTGGAAGTTTATGCTGTTTCAATT
GTTGGCCCATTTCCTACTGCTGTCACTAATTTATTAGATCTTACTAGACTGGATCTGCATAATAACAAGCTGACCGGCCCTCTTCCTTCT
CAAATTGGGCGTTTGAAGCGTCTTAAAATATTAAACGTAAGGTGGAATAAGCTGCAAGATGTCATTCCACCTGAAATAGGTGAACTAAAG
CAGCTAACACATCTCTACCTAAGTTTTAATAATTTCAAAGGCGAAATACCTAAGGAGCTTGCTAATCTTCCTGAGCTTCGTTATCTCCAT
CTGCATGAAAATCATTTTATTGGAAGAATTCCACCTGAGCTGGGTTCCTTACAGTATCTTCGACACCTGGATGTTGGTAACAATCGTTTG
GTTGGAACTATAAGAGAACTCATACGTATTGAAGGATGTTTTCCAGTTCTCCGCAACCTATACTTGAACAATAATTATCTTACTGGAGGC
ATTCCAGCGCAACTTGCTAATCTGACGAACTTGGAGATCTTGTATCTATCCTACAACAAGATGACAGGAGTTATACCATATAGCATTGCT
CATATTCCTAAGTTAACTTACTTGTATCTCGATCACAATCAATTTTCTGGGAGGATTCCAGATGCCTTCTACAAACACCCTTTCTTGAAG
GAAATGTACATTGACGAGAACACATTCCGGCCTGGTGTAAAACCAATCGGCCTGCATAAAGTGCTAGAACTTTCAGACGCAGATTTCCTT
GTTTAG\
Edits in Original Sequence 
TGTCTAAAAAAAAACTAATTTTGAGGAAAATTCCCAAAGTGAGTATTGATTTCACATAGATCTTCTTCCTTCACTTCCATCATCTCTCTC
AATCTCAGACTGCAGTAATGTACGTGTAGCTCTGCGTTTGGATTCCGGTTGATTTCAATAATTCTACTCTCCTGAAGGTGATTAACCCTA
TTCAA
(5')ATGGCTCXGCCATGGGCATCTACCTTCAGTATTTCTCCTGATCTTCTCGTTATGCTTGATCCGAAGCgTTCACGTTCACTC
TAAAACCCTGAAACGTGACGTGAAAGCTCTGAATGAAATTAAGGCATCTCTTGGATGGAGAGTGGTGTATGCATGGGTTGGAGATGATCC
TTGTGGAGATGGTGATTTACCTCCATGGTCTGGTGTTACATGTTCAACGCAGGGTGATTATAGAGTAGTTACTGAATTGGAAGTTTATGC
TGTTTCAATTGTTGGCCCATTTCCTACTGCTGTCACTAATTTATTAGATCTTACTAGACTGGATCTGCATAATAACAAGCTGACCGGCCC
TCTTCCTTCTCAAATTGGGCGTTTGAAGCGTCTTAAAATATTAAACGTAAGGTGGAATAAGCTGCAAGATGTCATTCCACCTGAAATAGG
TGAACTAAAGCAGCTAACACATCTCTACCTAAGTTTTAATAATTTCAAAGGCGAAATACCTAAGGAGCTTGCTAATCTTCCTGAGCTTCG
TTATCTCCATCTGCATGAAAATCATTTTATTGGAAGAATTCCACCTGAGCTGGGTTCCTTACAGTATCTTCGACACCTGGATGTTGGTAA
CAATCGTTTGGTTGGAACTATAAGAGAACTCATACGTATTGAAGGATGTTTTCCAGTTCTCCGCAACCTATACTTGAACAATAATTATCT
TACTGGAGGCATTCCAGCGCAACTTGCTAATCTGACGAACTTGGAGATCTTGTATCTATCCTACAACAAGATGACAGGAGTTATACCATA
TAGCATTGCTCATATTCCTAAGTTAACTTACTTGTATCTCGATCACAATCAATTTTCTGGGAGGATTCCAGATGCCTTCTACAAACACCC
TTTCTTGAAGGAAATGTACATTGACGAGAACACATTCCGGCCTGGTGTAAAACCAATCGGCCTGCATAAAGTGCTAGAACTTTCAGACGC
AGATTTCCTTGTTTAG\(3')AAAAAGCCAAGTACTGTTATTTATTCATGAGCAAAGTGTACCTAGGTTGTCGAATGAAGCAGCCGGTCC
CTGTTCTGTCAAGTGTCTATTCTTTAGTTGCCAGATGAGAAAAAAGGTTCCATCTTTTTGTGCAAAGAAGTAATCAACCAAACTTAGTTA
CTGTTGCTGTAGTTAAATAGTACCACGTTATGAATCATGAAGTAATTGCGACGTACGTCTTGATCAGTTCTCACTTGCCTTGAATTCTTG
CATTTGGTTTTTGAGTATACATGATACGATTTCAGAGTTAATATGAAAGGGTAGAAGAATATGCTCTGATTNAAAAAAAAAAAAAAAAAA
AAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan