ESTScan Details for Unigene SGN-U214123

Score 
386
Direction 
Forward
Predicted Peptide Sequence 
KPLFVPIPFFPAPIQTLNLSKAVSDRRLDSEQSRKRMIDRCMLAGKYGEVDFDARVTDGLPLAEGLDDGRDVQNADFYKQQVKALFKNLS
MRQNDASRMSIETGPYVFHYIIEGHVCYLTMCDRSYPKKLAFQYLEDLKNEFERANGSQIETAARPYAFIKFDTFIQKTKKLYQDTRTQR
NISKLNDELYEVHQIMTRNVQEVLGVGEKLDQVSQMSSRLTSESRIYADKAKDLNRQALIRKWAPVAIVLGVVFSSSGSEQRSGDASIQM
QLSDDNTVKCFIHICHHQTLHNPENHLTYSYPACVVPYQFYSVKEERNRDEXMSLNLEKLH
Predicted Coding Sequence 
XXAAAACCCCTCTTTGTTCCTATCCCATTTTTCCCAGCTCCGATTCAAACTCTTAACTTATCAAAGGCGGTCAGCGATCGGCGACTGGAT
TCCGAGCAGTCACGCAAGCGTATGATCGATCGCTGTATGCTTGCGGGAAAATATGGTGAAGTTGACTTTGATGCTCGCGTGACTGATGGC
CTTCCTTTAGCCGAGGGGCTGGATGATGGTCGTGATGTTCAAAATGCAGATTTCTACAAACAGCAGGTCAAGGCCTTATTCAAGAACCTG
TCGATGCGCCAAAATGACGCTTCAAGGATGTCTATTGAAACTGGACCTTACGTCTTCCATTATATCATTGAAGGGCATGTTTGTTATCTG
ACAATGTGTGATCGCTCTTATCCCAAGAAACTTGCCTTTCAATACCTGGAAGACCTTAAGAATGAGTTTGAGCGCGCCAATGGGAGTCAA
ATTGAAACTGCTGCTAGACCATATGCTTTTATTAAATTTGATACATTCATACAGAAGACGAAGAAACTGTACCAGGATACTAGAACTCAA
CGCAACATTTCTAAGTTGAATGATGAGCTTTACGAAGTTCATCAAATAATGACTCGAAATGTTCAAGAAGTTCTTGGAGTTGGTGAAAAG
TTGGACCAGGTCAGTCAAATGTCCAGCCGTTTGACATCTGAATCCCGGATATATGCTGATAAAGCAAAAGACTTAAATCGTCAGGCTTTG
ATTCGAAAATGGGCTCCTGTTGCTATTGTGCTTGGAGTTGTCTTCTCTTCTTCTGGCTCAGAACAAAGATCTGGTGATGCTTCCATACAG
ATGCAGCTCAGTGACGACAATACTGTCAAATGTTTTATTCATATTTGTCACCATCAGACTCTGCACAACCCAGAGAACCACCTCACTTAC
AGTTATCCAGCATGTGTTGTGCCATATCAGTTTTATAGTGTAAAAGAGGAAAGGAACCGCGATGAAXTTATGTCCCTTAACCTTGAGAAA
TTACATTAA\
Edits in Original Sequence 
(5')XXAAAACCCCTCTTTGTTCCTATCCCATTTaTTCCCAGCTCCGATTCAAACTCTTAACTTATCAAAGGCGGTCAGCGATCGGCGAC
TGGATTCCGAGCAGTCACGCAAGCGTATGATCGATCGCTGTATGCTTGCGGGAAAATATGGTGAAGTTGACTTTGAtTGCTCGCGTGACT
GATGGCCTTCCTTTAGCCGAGGGGCTGGATGATGGTCGTGATGTTCAAAATGCAGATTTCTACAAACAGCAGGTCAAGGCCTTATTCAAG
AACCTGTCGATGCGCCAAAATGACGCTTCAAGGATGTCTATTGAAACTGGACCTTACGTCTTCCATTATATCATTGAAGGGCATGTTTGT
TATCTGACAATGTGTGATCGCTCTTATCCCAAGAAACTTGCCTTTCAATACCTGGAAGACCTTAAGAATGAGTTTGAGCGCGCCAATGGG
AGTCAAATTGAAACTGCTGCTAGACCATATGCTTTTATTAAATTTGATACATTCATACAGAAGACGAAGAAACTGTACCAGGATACTAGA
ACTCAACGCAACATTTCTAAGTTGAATGATGAGCTTTACGAAGTTCATCAAATAATGACTCGAAATGTTCAAGAAGTTCTTGGAGTTGGT
GAAAAGTTGGACCAGGTCAGTCAAATGTCCAGCCGTTTGACATCTGAATCCCGGATATATGCTGATAAAGCAAAAGACTTAAATCGTCAG
GCTTTGATTCGAAAATGGGCTCCTGTTGCTATTGTGCTTGGAGTTGTCaTTCTCTTCTTCTGGCTCAGAACAAAGATCTGGTGATGCTTC
CATACAGATGCAGCTCAGTGACGACAATACTGTCAAATGTTTTATTCATATTTGTCACCATCAGACTCTGCACAACCCAGAGAACCACCT
CACaTTACAGTTATCCAGCATGTGTTGTGCCATATCAGTTTTATAGTGTAAAAGAGGAAAGGAACCGCGATGAAXTTATGTCCCTTAACC
TTGAGAAATTACATTAA\(3')TTTTGGCTCTCTTTTATATATTGTCTTGTTAGTTTAGCTTCAAAACTCCAACAAGTAGCTCATTGTAG
TTTCAGCTATGAAACTAACTTATTTCAGAATATACAGCAAATATAAACAATCCTTCAGACTGTTAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan