ESTScan Details for Unigene SGN-U214318

Score 
609
Direction 
Forward
Predicted Peptide Sequence 
IGAFLDANSFVCMFDNSLIDKTDTLGGTFKPGKEYYGGYRPVAFIDTKDPNHAALKGYILSSFAKRHNLFIPLFRNTLSDHLFNNLEKQV
TEQGKADFNALLPTMTFDFIFRLLCDQKNPAKKLPNIIEDMLFHNFLIPFGFIKSDYNKLVDAFSKSAVSMLDEAEKLGIKREEAVQNIL
FLVGINMFAGLNAFFPHLFRFVGEAGASLHTQLAKEIRSVIKEEGGAITLSAINKMSLVKSVVYENIX
Predicted Coding Sequence 
XXAATTGGTGCCTTTTTAGATGCCAATAGCTTTGTTTGCATGTTTGATAATTCCCTCATTGATAAAACTGACACTCTTGGTGGTACATTT
AAGCCTGGTAAAGAATACTACGGTGGTTATCGTCCCGTCGCGTTTATCGATACCAAAGATCCAAACCACGCAGCATTAAAAGGCTACATT
TTATCATCATTCGCAAAGCGACATAACTTATTCATTCCTCTGTTCAGAAACACGTTATCCGATCATCTTTTTAATAATCTCGAAAAACAG
GTTACTGAACAGGGGAAAGCAGATTTCAATGCTTTGCTTCCGACTATGACGTTTGATTTCATTTTTCGTTTGCTTTGTGATCAGAAAAAT
CCXGCCAAGAAACTTCCTAACATCATAGAAGATATGCTCTTCCATAATTTTTTAATACCATTTGGTTTTATAAAGAGTGATTACAACAAA
CTTGTTGATGCATTTAGCAAGTCTGCTGTGTCCATGTTGGATGAAGCAGAAAAACTTGGAATCAAAAGAGAAGAAGCTGTACAAAACATT
CTTTTTCTCGTGGGGATCAATATGTTTGCGGGGCTGAACGCCTTTTTCCCTCATCTATTCAGGTTTGTGGGCGAAGCAGGGGCTAGTCTA
CACACACAACTTGCTAAAGAAATCAGGAGTGTTATTAAAGAAGAAGGTGGTGCAATCACATTATCAGCGATTAACAAAATGAGTTTGGTC
AAATCGGTAGTGTACGAGAACATTGAX\
Edits in Original Sequence 
(5')XXAATTGGTaGCCTTTTTAGATGCCAATAGCTTTGTTTGCATGTTTGATAATTCCCTCATTGATAAAACTGACACTCTTGGTGGTA
CATTTAAGCCTGGTAAAGAATACTACGGTGGTTATCGTCCCGTCGCGTTTATCGATACCAAAGATCCAAACCACGCAGCATTAAAAGGCT
ACATTTTATCATCATTCGCAAAGCGACATAACTTATTCATTCCTCTGTTCAGAAACACGTTATCCGATCATCTTTTTAATAATCTCGAAA
AACAGGTTACTGAACAGGGGAAAGCAGATTTCAATGCTTTGCTTCCGACTATGACGTTTGATTTCATTTTTCGTTTGCTTTGTGATCAGA
AAAATCCXGCCAAGAAACTTCCTAACATCATAGAAGATATGCTCTTCCATAATTTTTTAATACCATTTGGTTTTATAAAGAGTGATTACA
ACAAACTTGTTGATGCATTTAGCAAGTCTGCTGTGTCCATGTTGGATGAAGCAGAAAAACTTGGAATCAAAAGAGAAGAAGCTGTACAAA
ACATTCTTTTTCTCGTGGGGATCAATATGTTTGCGGGGCTGAACGCCTTTTTCCCTCATCTATTCAGGTTTGTGGGCGAAGCAGGGGCTA
GTCTACACACACAACTTGCTAAAGAAATCAGGAGTGTTATTAAAGAAGAAGGTGGTGCAATCACATTATCAGCGATTAACAAAATGAGTT
TGGTCAAATCGGTAGTGTACGAGAACATTGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan