ESTScan Details for Unigene SGN-U214327

Score 
1095
Direction 
Forward
Predicted Peptide Sequence 
MYSNFKEQAIEYVRQAVQEDNSGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFTEYLRRAEEIRAVLDEGGSGPGPNGGDAAVI
AKPKTKPKDGEDGEDPEQSKLRAGLNSAIVREKPNVKWNDVAGLESAKQALQEAVILPVKFPQFFTGKRRPWRAFLLYGPPGTGKSYLAK
AVATEAESTFFSVSSSDLVSKWMGESEKLVSNLFQMARESAPSIIFVDEIDSLCGQRGEGNESEASRRIKTELLVQMQGVGHNDDKVLVL
AATNTPYSLDQAIRRRFDKRIYIPLPDLKARQHMFKVHLGDTPHNLNECDFEDLARKTEGFSGSDVSVCVKDVLFEPVRKTQDAVFFTQT
SNGTWIPCGPKQRGAVQTTMQELAAKGLASQIIPPPITKTDFDKVLARQRPTVSKSDLEVHDRFTRNLEKKVEEIDXVSDNYYAW
Predicted Coding Sequence 
ATGTATAGCAATTTCAAGGAGCAAGCAATTGAGTACGTAAGGCAAGCAGTGCAAGAGGACAATAGTGGAAACTATGCAAAGGCATTTCCG
TTGTATATGAATGCATTGGAGTACTTCAAGACCCATTTGAAGTACGAGAAGAATCCTAAGATTAAGGAGGCAATTACCCAGAAATTTACA
GAGTATTTACGCCGGGCGGAGGAGATTCGGGCTGTGTTGGATGAGGGTGGGAGTGGGCCTGGTCCAAATGGAGGAGATGCTGCTGTAATT
GCTAAGCCTAAGACTAAGCCTAAGGATGGTGAGGATGGTGAGGATCCTGAGCAGTCTAAGCTAAGGGCTGGGCTTAATTCAGCAATTGTT
AGAGAAAAACCTAATGTGAAGTGGAATGATGTTGCTGGATTGGAGAGTGCTAAACAGGCGTTGCAGGAAGCTGTCATTTTGCCTGTGAAA
TTCCCTCAGTTCTTCACAGGAAAGAGGCGACCATGGAGAGCTTTTCTTCTTTATGGTCCTCCTGGGACAGGAAAGTCTTACTTGGCGAAA
GCTGTTGCTACTGAAGCGGAATCCACTTTTTTTAGTGTCTCGTCATCAGACCTTGTATCCAAGTGGATGGGTGAAAGTGAAAAGCTAGTT
TCGAACCTCTTCCAAATGGCTCGAGAAAGCGCTCCATCCATTATATTTGTTGATGAAATTGATTCCTTGTGTGGGCAGCGAGGAGAAGGA
AATGAAAGTGAAGCTTCTCGACGTATTAAAACAGAACTCCTTGTGCAGATGCAGGGTGTTGGTCACAATGATGATAAAGTTCTTGTACTT
GCGGCAACAAATACACCCTATTCCCTAGATCAGGCTATACGGCGAAGATTTGATAAGCGTATCTACATTCCGCTCCCTGATTTGAAGGCA
CGGCAACACATGTTCAAAGTTCATTTAGGTGATACCCCCCATAACTTGAACGAGTGTGACTTTGAAGACCTGGCCCGTAAGACAGAAGGT
TTTTCTGGTTCAGATGTTTCTGTTTGTGTCAAGGACGTGCTATTTGAACCTGTACGTAAGACACAAGATGCTGTGTTCTTTACTCAAACT
TCTAATGGTACCTGGATTCCATGCGGACCGAAGCAACGGGGTGCTGTGCAGACAACTATGCAGGAACTTGCTGCTAAAGGACTCGCGTCC
CAGATCATCCCGCCACCCATTACAAAGACTGATTTTGATAAGGTTCTTGCTCGTCAAAGGCCAACAGTTAGTAAATCCGACCTTGAAGTG
CATGACAGATTCACAAGGAATTTGGAGAAGAAGGTTGAAGAGATTGATGXTGTTTCCGATAACTACTACGCCTGG\
Edits in Original Sequence 
TCGTGCCGAATTCGGCACGAGACTTTTCCCCTGTAAATTCAACGTTCAAACTCACAAATTACGATTCTTTCAAATGTTTTCTTCTTTCAT
AATCCAACTTTCGATCTCTAATCAATCTTTTTCTTAAGCCAAAACCAAAATCCCCAATTTTTAGGGTTCCTAATCCACCCAAAAAAGCTC
AAAATCTTCAAAAAGATCCATTTCTCAGAGCACTGTTTATTGGATATTTTTTCTTAAATCAACTTTTTTCGAATACCCTTTTGAGTTCTG
ATGAAAACCCATTAATTTTCTTGGTTAGTTTGGTAGTTTTTCAGACACCCTTTTGAGTTCTGATCAAACCCTGAAATTTGCTTGGTTAGT
ATTGTGGTTTATTTTATTTTATATGATCGAAG
(5')ATGTATAGCAATTTCAAGGAGCAAGCAATTGAGTACGTAAGGCAAGCAGTGCAA
GAGGACAATAGTGGAAACTATGCAAAGGCATTTCCGTTGTATATGAATGCATTGGAGTACTTCAAGACCCATTTGAAGTACGAGAAGAAT
CCTAAGATTAAGGAGGCAATTACCCAGAAATTTACAGAGTATTTACGCCGGGCGGAGGAGATTCGGGCTGTGTTGGATGAGGGTGGGAGT
GGGCCTGGTCCAAATGGAGGAGATGCTGCTGTAATTGCTAAGCCTAAGACTAAGCCTAAGGATGGTGAGGATGGTGAGGATCCTGAGCAG
TCTAAGCTAAGGGCTGGGCTTAATTCAGCAATTGTTAGAGAAAAACCTAATGTGAAGTGGAATGATGTTGCTGGATTGGAGAGTGCTAAA
CAGGCGTTGCAGGAAGCTGTCATTTTGCCTGTGAAATTCCCTCAGTTCTTCACAGGAAAGAGGCGACCATGGAGAGCTTTTCTTCTTTAT
GGTCCTCCTGGGACAGGAAAGTCTTACTTGGCGAAAGCTGTTGCTACTGAAGCGGAATCCACTTTTTTTAGTGTCTCGTCATCAGACCTT
GTATCCAAGTGGATGGGTGAAAGTGAAAAGCTAGTTTCGAACCTCTTCCAAATGGCTCGAGAAAGCGCTCCATCCATTATATTTGTTGAT
GAAATTGATTCCTTGTGTGGGCAGCGAGGAGAAGGAAATGAAAGTGAAGCTTCTCGACGTATTAAAACAGAACTCCTTGTGCAGATGCAG
GGTGTTGGTCACAATGATGATAAAGTTCTTGTACTTGCGGCAACAAATACACCCTATTCCCTAGATCAGGCTATACGGCGAAGATTTGAT
AAGCGTATCTACATTCCGCTCCCTGATTTGAAGGCACGGCAACACATGTTCAAAGTTCATTTAGGTGATACCCCCCATAACTTGAACGAG
TGTGACTTTGAAGACCTGGCCCGTAAGACAGAAGGTTTTTCTGGTTCAGATGTTTCTGTTTGTGTCAAGGACGTGCTATTTGAACCTGTA
CGTAAGACACAAGATGCTGTGTTCTTTACTCAAACTTCTAATGGTACCTGGATTCCATGCGGACCGAAGCAACGGGGTGCTGTGCAGACA
ACTATGCAGGAACTTGCTGCTAAAGGACTCGCGTCCCAGATCATCCCGCCACCCATTACAAAGACTGATTTTGATAAGGTTCTTGCTCGT
CAAAGGCCAACAGTTAGTAAATCCGACCTTGAAGTGCATGACAGATTCACgAAGGAATTTGGAGAAGAAGGTTGAAGAGATTGATGXTGT
TTCCGATAACTACTACGCCTGG\(3')AGTTGCCGTGATTTGTATTTTTTCTCCCTTCTACTTGTCTGAAAAATTTGCGATTTTCAAAGG
TTCTTCAAATGGGAGAGATTGACATTGTTTACCTTCTTGGATTGTATCAGTTTTAGCTTTGCATGTATTTATCAATGTCAAGACAGAACA
TTTTGCTAGTATTTTTGTTGTATTTCCTTTTAAAATACTAATTGCAATTACTTTGTAATCAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan