ESTScan Details for Unigene SGN-U214395

Score 
1197
Direction 
Forward
Predicted Peptide Sequence 
QNSAAPFSSPIFSANARGGDAPPSVPSRRSSSLPPPRSSLPLLHSSELPRSSDQQRPVREGSAATGDNRQQPAEPENSIFSLLFSGEPHQ
QQHRRGPPRSSNFGKAPSGKPANNSXQQAVAATPVSSISTAAATAQNSSGQSAPAKSKILDRWKTDLSPSFEMEDTPKAEDQLPEGASES
APQKMLETREEMLSRHRKEISKLQDKEIAMKKAAAKGSKAEQKAKKKQVDEEVSKLSAKLKEGHAGELASLGYGDDSNNDNGKDKGNLDT
LVKAIAGVSVSSQTDHSKPSKSVKRREKRAQQEAAREQRIQEEQSNIISDRVIENEKLERKLEPLGLTVNEIKPDGHCLYRAVENQLAIH
TGGSSPYSYLELRQMVAAYMRKHATDFLPFFLSENAEEGESDDSLVGRFENYCREVESTAAWGGQLELGALTHILKKHIMIFSGSFPDVE
MGKEYKSSSGSGSGSSAFSIMLSYHKHAFGLGEHYNSLIPSSA
Predicted Coding Sequence 
CAAAATTCAGCCGCCCCCTTCTCCTCTCCAATTTTCTCGGCGAACGCCAGAGGTGGCGACGCTCCACCCTCGGTTCCCAGCCGCCGCTCC
TCCTCCTTGCCTCCACCTCGCTCTTCTCTTCCTCTTCTCCACTCCAGCGAGCTGCCACGCAGCTCCGACCAGCAGCGACCAGTGAGAGAG
GGCAGCGCTGCAACCGGAGACAACCGCCAGCAGCCAGCAGAGCCGGAAAACTCTATTTTCTCTCTTCTCTTTTCCGGCGAACCCCACCAG
CAGCAGCACCGTCGAGGACCACCGCGAAGCAGCAACTTCGGTAAGGCGCCATCAGGAAAACCTGCAAACAATAGCXTCCAACAGGCAGTA
GCAGCAACTCCAGTGAGCTCAATATCAACAGCAGCAGCAACTGCTCAAAACAGCTCCGGCCAATCAGCTCCGGCGAAGTCCAAAATTTTG
GATCGGTGGAAGACGGATCTGTCTCCGAGTTTTGAAATGGAGGATACACCTAAAGCAGAAGATCAGTTGCCTGAGGGAGCATCAGAAAGT
GCGCCTCAGAAGATGCTAGAAACCCGCGAGGAGATGCTTTCTAGGCATAGGAAAGAAATTTCTAAGCTACAGGACAAAGAAATTGCTATG
AAAAAGGCAGCAGCTAAAGGAAGCAAAGCTGAACAGAAAGCTAAGAAAAAACAAGTGGATGAAGAAGTATCTAAACTTTCTGCAAAGCTC
AAAGAAGGACATGCTGGGGAACTTGCTTCTTTAGGCTACGGTGATGATAGTAATAATGATAATGGAAAGGATAAAGGGAATCTGGATACA
TTGGTGAAGGCCATTGCTGGGGTTTCTGTCAGTAGTCAAACTGACCATTCAAAACCCAGCAAGAGCGTGAAGAGACGTGAGAAAAGAGCT
CAACAAGAGGCAGCCAGAGAGCAGAGAATACAAGAAGAGCAGAGTAATATCATAAGTGATCGGGTTATTGAGAATGAAAAGTTAGAAAGA
AAGCTTGAGCCTCTTGGATTGACTGTTAACGAAATAAAGCCTGACGGACACTGTCTTTACCGAGCTGTGGAGAATCAGTTGGCCATCCAC
ACTGGCGGTTCATCTCCTTATTCATATCTTGAACTGCGACAGATGGTGGCAGCTTACATGAGGAAACATGCAACTGACTTTCTCCCTTTT
TTCCTCTCTGAGAATGCAGAAGAAGGAGAATCAGATGATTCTCTTGTAGGAAGGTTCGAGAATTACTGTAGAGAAGTTGAGTCAACTGCT
GCATGGGGAGGACAACTTGAGCTTGGTGCTTTAACTCACATCTTAAAGAAACATATAATGATATTTTCAGGGTCATTTCCTGATGTGGAG
ATGGGAAAGGAATACAAATCCAGCAGTGGCTCTGGCTCTGGCTCTTCAGCTTTCAGTATAATGCTATCTTACCACAAGCATGCTTTTGGG
CTTGGTGAGCACTATAACTCACTTATTCCCAGTTCAGCTTAA\
Edits in Original Sequence 
GAATTCGGCACGAGGCTAAAATTCACTCATTCTCTCCCTCTCTTCTC(5')CAAAATTCAGCCGCCCCCTTCTCCTCTCCAATTTTCTCG
GCGAACGCCAGAGGTGGCGACGCTCCACCCTCGGTTCCCAGCCGCCGCTCCTCCTCCTTGCCTCCACCTCGCTCTTCTCTTCCTCTTCTC
CACTCCAGCGAGCTGCCACGCAGCTCCGACCAGCAGCGACCAGTGAGAGAGGGCAGCGCTGCAACCGGAGACAACCGCCAGCAGCCAGCg
AGAGCCGGAAAACTCTATTTTCTCTCTTCTCTTTTCCGGCGAACCCCACCAGCAGCAGCgACCGTCGAGGACCACCGCGAAGCAGCAACT
TCGGTAAGGCGCCATCAGtGAAAACCTGCAAACAATAGCXTCCAACAGGCAGTAGCAGCAACTCCAGTGAGCTCAATATCAACAGCAGCA
GCAACTGCTCAAAACAGCTCCGGCCAATCgAGCTCCGGCGAAGTCCAAAATTTTGGATCGGTGGAAGACGGATCTGTCTCCGAGTTTTGA
AATGGAGGATACACCTAAAGCAGAAGATCAGTTGCCTGAGGGAGCATCAGAAAGTGCGCCTCAGAAGATGCTAGAAACCCGCGAGGAGAT
GCTTTCTAGGCATAGGAAAGAAATTTCTAAGCTACAGGACAAAGAAATTGCTATGAAAAAGGCAGCAGCTAAAGGAAGCAAAGCTGAACA
GAAAGCTAAGAAAAAACAAGTGGATGAAGAAGTATCTAAACTTTCTGCAAAGCTCAAAGAAGGACATGCTGGGGAACTTGCTTCTTTAGG
CTACGGTGATGATAGTAATAATGATAATGGAAAGGATAAAGGGAATCTGGATACATTGGTGAAGGCCATTGCTGGGGTTTCTGTCAGTAG
TCAAACTGACCATTCAAAACCCAGCAAGAGCGTGAAGAGACGTGAGAAAAGAGCTCAACAAGAGGCAGCCAGAGAGCAGAGAATACAAGA
AGAGCAGAGTAATATCATAAGTGATCGGGTTATTGAGAATGAAAAGTTAGAAAGAAAGCTTGAGCCTCTTGGATTGACTGTTAACGAAAT
AAAGCCTGACGGACACTGTCTTTACCGAGCTGTGGAGAATCAGTTGGCCATCCACACTGGCGGTTCATCTCCTTATTCATATCTTGAACT
GCGACAGATGGTGGCAGCTTACATGAGGAAACATGCAACTGACTTTCTCCCTTTTTTCCTCTCTGAGAATGCAGAAGAAGGAGAATCAGA
TGATTCTCTTGTAGGAAGGTTCGAGAATTACTGTAGAGAAGTTGAGTCAACTGCTGCATGGGGAGGACAACTTGAGCTTGGTGCTTTAAC
TCACATCTTAAAGAAACATATAATGATATTTTCAGGGTCATTTCCTGATGTGGAGATGGGAAAGGAATACAAATCCAGCAGTGGCTCTGG
CTCTGGCTCTTCAGCTTTCAGTATAATGCTATCTTACCACAAGCATGCTTTTGGGCTTGGTGAGCACTATAACTCACTTATTCCCAGTTC
AGCTTAA\(3')TAGGTTTGATTTTTATTGTGGAAAACAAATGTTCACAGCAACATGATAGCTCAACTGATATCATGATTTACAGCAAAG
CAATCTAGCAACAGTTTCATTTGTGTCATATGTTTCGAGTTCAATGCGTTTTGTCTTTCTACAATGTTACTATAGGACTAAATCCTAACT
TATGGATTTGGTTTTCTGTTTTGTGATAACTCTTACTTCCTTTCGTTCGTATTCCAAATTAAGAGTTTCTCTGATTTGTTTTCAGTAAAA
AAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan